ABCE1 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258061-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP258061 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
ABCE1
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
2'-5'-oligoadenylate-binding protein, ATP-binding cassette, sub-family E (OABP), member 1, HuHP68, OABP, Ribonuclease 4 inhibitor, ribonuclease L (2'-5'-oligoisoadenylate synthetase-dependent) inhibitor, RLIABC38, RNase L inhibitor, RNASEL1, RNASELIRNS4IATP-binding cassette sub-family E member 1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
ABCE1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITIRSLINP
Quantity
100 μL
Research Discipline
ABC Transporters, Immune System Diseases, Immunology, Lipid and Metabolism, Membrane Trafficking and Chaperones, Plasma Membrane Markers, Signal Transduction
Gene ID (Entrez)
6059
Target Species
Human
Isotype
IgG
Related Products
Description
- ABCE1 Polyclonal specifically detects ABCE1 in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: ABCE1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: 2'-5'-oligoadenylate-binding protein, ATP-binding cassette, sub-family E (OABP), member 1, HuHP68, OABP, Ribonuclease 4 inhibitor, ribonuclease L (2'-5'-oligoisoadenylate synthetase-dependent) inhibitor, RLIABC38, RNase L inhibitor, RNASEL1, RNASELIRNS4IATP-binding cassette sub-family E member 1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ABCE1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITIRSLINP
Quantity: 100 μL
Research Discipline: ABC Transporters, Immune System Diseases, Immunology, Lipid and Metabolism, Membrane Trafficking and Chaperones, Plasma Membrane Markers, Signal Transduction
Gene ID (Entrez): 6059
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: 2'-5'-oligoadenylate-binding protein, ATP-binding cassette, sub-family E (OABP), member 1, HuHP68, OABP, Ribonuclease 4 inhibitor, ribonuclease L (2'-5'-oligoisoadenylate synthetase-dependent) inhibitor, RLIABC38, RNase L inhibitor, RNASEL1, RNASELIRNS4IA
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 6059
Target Species: __
Isotype: __
Antigen: HAND2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: BHLHA26, bHLHa26MGC125303, dHAND, DHAND2, FLJ16260, heart and neural crest derivatives expressed 2, heart, autonomic nervous system and neural crestderivatives-expressed protein 2, Hed, MGC125304, Thing2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: HAND2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SLVGGFPHHPVVHHEGYPFAAAAAAAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSY
Quantity: 100 μL
Research Discipline: Angiogenesis
Gene ID (Entrez): 9464
Target Species: Human
Isotype: IgG