CRIF1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258099-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP258099 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
CRIF1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
CKBBP2, CKII beta-associating protein, CR6 interacting factor 1, CRIF1p53-responsive gene 6 protein, growth arrest and DNA damage-inducible proteins-interacting protein 1, growth arrest and DNA-damage-inducible, gamma interacting protein 1, MGC4667, MGC4758, papillomavirus L2 interacting nuclear protein 1, Papillomavirus L2-interacting nuclear protein 1, Plinp1, PLINP-1CKII beta binding protein 2, PRG6CR6-interacting factor 1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
GADD45GIP1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ELEAEEREWYPSLATMQESLRVKQLAEEQKRRER
Quantity
100 μL
Research Discipline
Cancer
Gene ID (Entrez)
90480
Target Species
Human
Isotype
IgG
Related Products
Description
- CRIF1 Polyclonal specifically detects CRIF1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: CRIF1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: CKBBP2, CKII beta-associating protein, CR6 interacting factor 1, CRIF1p53-responsive gene 6 protein, growth arrest and DNA damage-inducible proteins-interacting protein 1, growth arrest and DNA-damage-inducible, gamma interacting protein 1, MGC4667, MGC4758, papillomavirus L2 interacting nuclear protein 1, Papillomavirus L2-interacting nuclear protein 1, Plinp1, PLINP-1CKII beta binding protein 2, PRG6CR6-interacting factor 1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: GADD45GIP1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ELEAEEREWYPSLATMQESLRVKQLAEEQKRRER
Quantity: 100 μL
Research Discipline: Cancer
Gene ID (Entrez): 90480
Target Species: Human
Isotype: IgG
Antigen: Cytokeratin 12
Classification: Polyclonal
Dilution: Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: keratin, type I cytoskeletal 12, CK12, K12, keratin 12
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: KRT12
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LGAGYGRALGGGSFGGLGMGFGGSPGGGSLGILSGNDGGLLSGS
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 3859
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: keratin, type I cytoskeletal 12, K12, keratin 12
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20 C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1 M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 3859
Target Species: __
Isotype: __
