TL1A/TNFSF15 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258139-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP258139 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
TL1A/TNFSF15
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
MGC129934, MGC129935, TL1A, TL1Vascular endothelial cell growth inhibitor, TNF superfamily ligand TL1A, tumor necrosis factor (ligand) superfamily, member 15, tumor necrosis factor ligand superfamily member 15, vascular endothelial growth inhibitor-192A, VEGI192A, VEGITNF ligand-related molecule 1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
TNFSF15
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQ
Quantity
100 μL
Research Discipline
Apoptosis, Cell Cycle and Replication
Gene ID (Entrez)
9966
Target Species
Human
Isotype
IgG
Related Products
Description
- TL1A/TNFSF15 Polyclonal specifically detects TL1A/TNFSF15 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: TL1A/TNFSF15
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: MGC129934, MGC129935, TL1A, TL1Vascular endothelial cell growth inhibitor, TNF superfamily ligand TL1A, tumor necrosis factor (ligand) superfamily, member 15, tumor necrosis factor ligand superfamily member 15, vascular endothelial growth inhibitor-192A, VEGI192A, VEGITNF ligand-related molecule 1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: TNFSF15
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQ
Quantity: 100 μL
Research Discipline: Apoptosis, Cell Cycle and Replication
Gene ID (Entrez): 9966
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: MGC129934, MGC129935, TL1A, TL1Vascular endothelial cell growth inhibitor, TNF superfamily ligand TL1A, tumor necrosis factor (ligand) superfamily, member 15, tumor necrosis factor ligand superfamily member 15, vascular endothelial growth inhibitor-192A,
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 9966
Target Species: __
Isotype: __
Antigen: FOXRED1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: FAD-dependent oxidoreductase domain containing 1, FAD-dependent oxidoreductase domain-containing protein 1, H17
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: FOXRED1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LSVGGIRQQFSLPENIQLSLFSASFLRNINEYLAVVDAPPLDLRFNPSGYLLLASEKDAAAMESNVKVQRQEGAKVSLMSPDQLRNK
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 55572
Target Species: Human
Isotype: IgG