SR140 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258175-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP258175 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
SR140
Classification
Polyclonal
Dilution
Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias
140 kDa Ser/Arg-rich domain protein, fSAPa, KIAA0332, SR140, U2 snRNP-associated SURP domain containing, U2 snRNP-associated SURP motif-containing protein, U2-associated protein SR140
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
23350
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
U2SURP
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MVFCLNNAEAAEEIVDCITESLSILKTPLPKKIARLYLVSDVLYNSSAKVANASYYRKFFETKLCQIFSDLNATYRTIQGHLQSENFKQRV
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- SR140 Polyclonal specifically detects SR140 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: SR140
Classification: Polyclonal
Dilution: Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: 140 kDa Ser/Arg-rich domain protein, fSAPa, KIAA0332, SR140, U2 snRNP-associated SURP domain containing, U2 snRNP-associated SURP motif-containing protein, U2-associated protein SR140
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 23350
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: U2SURP
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MVFCLNNAEAAEEIVDCITESLSILKTPLPKKIARLYLVSDVLYNSSAKVANASYYRKFFETKLCQIFSDLNATYRTIQGHLQSENFKQRV
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: 140 kDa Ser/Arg-rich domain protein, fSAPa, KIAA0332, SR140, U2 snRNP-associated SURP domain containing, U2 snRNP-associated SURP motif-containing protein, U2-associated protein SR140
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 23350
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: hair, basic, 4, hard keratin, type II, 4, K84, keratin 84, keratin, type II cuticular Hb4, keratin-84, KRTHB4, type II hair keratin Hb4
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 3890
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
