WNK1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258438-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP258438 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
WNK1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
EC 2.7.11, EC 2.7.11.1, Erythrocyte 65 kDa protein, HSAN2hereditary sensory neuropathy, type II, HSN2MGC163339, hWNK1, KDPMGC163341, KIAA0344, Kinase deficient protein, p65, PHA2C, PRKWNK1PSK, prostate-derived sterile 20-like kinase, Protein kinase lysine-deficient 1, Protein kinase with no lysine 1, protein kinase, lysine deficient 1, serine/threonine-protein kinase WNK1, WNK lysine deficient protein kinase 1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
WNK1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PPFPAPSLTQSQQPLEDLDAQLRRTLSPEMITVTSAVGPVSMAAPTAITEAGTQPQKGVSQVKEGPVLATSSGAGVFKMGRFQVSVAADGA
Quantity
100 μL
Research Discipline
Protein Kinase, Signal Transduction, Transcription Factors and Regulators
Gene ID (Entrez)
65125
Target Species
Human
Isotype
IgG
Related Products
Description
- WNK1 Polyclonal specifically detects WNK1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: WNK1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: EC 2.7.11, EC 2.7.11.1, Erythrocyte 65 kDa protein, HSAN2hereditary sensory neuropathy, type II, HSN2MGC163339, hWNK1, KDPMGC163341, KIAA0344, Kinase deficient protein, p65, PHA2C, PRKWNK1PSK, prostate-derived sterile 20-like kinase, Protein kinase lysine-deficient 1, Protein kinase with no lysine 1, protein kinase, lysine deficient 1, serine/threonine-protein kinase WNK1, WNK lysine deficient protein kinase 1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: WNK1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PPFPAPSLTQSQQPLEDLDAQLRRTLSPEMITVTSAVGPVSMAAPTAITEAGTQPQKGVSQVKEGPVLATSSGAGVFKMGRFQVSVAADGA
Quantity: 100 μL
Research Discipline: Protein Kinase, Signal Transduction, Transcription Factors and Regulators
Gene ID (Entrez): 65125
Target Species: Human
Isotype: IgG
Antigen: STIL
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL
Gene Alias: MCPH7, SCL/TAL1 Interrupting Locus, SCL-Interrupting Locus Protein, SIL, TAL1 (SCL) Interrupting Locus, TAL-1-Interrupting Locus Protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: STIL
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RLLEAQSLMPCSPKTTAVEDTVQAGRQMELVSVEAQSSPGLHMRKGVSIAVSTGASLFWNAAGEDQEPDSQMKQDDTKI
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 6491
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: MCPH7, SCL/TAL1 Interrupting Locus, SCL-Interrupting Locus Protein, SIL, TAL1 (SCL) Interrupting Locus, TAL-1-Interrupting Locus Protein
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 6491
Target Species: __
Isotype: __