CDKN3 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258459-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP258459 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
CDKN3
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
CDI1KAP1, CDK2-associated dual specificity phosphatase, CDK2-associated dual-specificity phosphatase, Cdk-associated protein phosphatase, CIP2, cyclin-dependent kinase inhibitor 3, cyclin-dependent kinase interacting protein 2, Cyclin-dependent kinase interactor 1, Cyclin-dependent kinase-interacting protein 2, EC 3.1.3.16, EC 3.1.3.48, FLJ25787, KAPMGC70625, Kinase-associated phosphatase
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
CDKN3
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
Quantity
100 μL
Research Discipline
Cell Cycle and Replication, Core ESC Like Genes, Protein Phosphatase, Stem Cell Markers
Gene ID (Entrez)
1033
Target Species
Human
Isotype
IgG
Related Products
Description
- CDKN3 Polyclonal specifically detects CDKN3 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: CDKN3
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: CDI1KAP1, CDK2-associated dual specificity phosphatase, CDK2-associated dual-specificity phosphatase, Cdk-associated protein phosphatase, CIP2, cyclin-dependent kinase inhibitor 3, cyclin-dependent kinase interacting protein 2, Cyclin-dependent kinase interactor 1, Cyclin-dependent kinase-interacting protein 2, EC 3.1.3.16, EC 3.1.3.48, FLJ25787, KAPMGC70625, Kinase-associated phosphatase
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: CDKN3
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
Quantity: 100 μL
Research Discipline: Cell Cycle and Replication, Core ESC Like Genes, Protein Phosphatase, Stem Cell Markers
Gene ID (Entrez): 1033
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: apolipoprotein L domain containing 1, apolipoprotein L domain-containing protein 1, DKFZP434F0318, FLJ25138, FLJ95166, Vascular early response gene protein, VERGEDKFZp434F0318
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 81575
Target Species: __
Isotype: __
Antigen: RGM-A
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: RGM domain family member A, RGM domain family, member A, RGMrepulsive guidance molecule A
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: RGMA
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TSQPRLRTLPPAGDSQERSDSPEICHYEKSFHKHSATPNYTHCGLFG
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 56963
Target Species: Human
Isotype: IgG
