LSD1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258483-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP258483 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
LSD1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
amine oxidase (flavin containing) domain 2, AOF2lysine-specific histone demethylase 1, BHC110FAD-binding protein BRAF35-HDAC complex, 110 kDa subunit, Flavin-containing amine oxidase domain-containing protein 2, KIAA0601KDM1, LSD1BRAF35-HDAC complex protein BHC110, lysine (K)-specific demethylase 1, lysine (K)-specific demethylase 1A, lysine-specific histone demethylase 1A
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
KDM1A
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIY
Quantity
100 μL
Research Discipline
Chromatin Modifiers, DNA Repair, DNA replication Transcription Translation and Splicing, Epigenetics
Gene ID (Entrez)
23028
Target Species
Human
Isotype
IgG
Related Products
Description
- LSD1 Polyclonal specifically detects LSD1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: LSD1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: amine oxidase (flavin containing) domain 2, AOF2lysine-specific histone demethylase 1, BHC110FAD-binding protein BRAF35-HDAC complex, 110 kDa subunit, Flavin-containing amine oxidase domain-containing protein 2, KIAA0601KDM1, LSD1BRAF35-HDAC complex protein BHC110, lysine (K)-specific demethylase 1, lysine (K)-specific demethylase 1A, lysine-specific histone demethylase 1A
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: KDM1A
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIY
Quantity: 100 μL
Research Discipline: Chromatin Modifiers, DNA Repair, DNA replication Transcription Translation and Splicing, Epigenetics
Gene ID (Entrez): 23028
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: amine oxidase (flavin containing) domain 2, AOF2lysine-specific histone demethylase 1, BHC110FAD-binding protein BRAF35-HDAC complex, 110 kDa subunit, Flavin-containing amine oxidase domain-containing protein 2, KIAA0601KDM1, LSD1BRAF35-HDAC complex prote
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 23028
Target Species: __
Isotype: __
Antigen: Nardilysin
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: EC 3.4.24, EC 3.4.24.61, hNRD1, hNRD2, nardilysin, nardilysin (N-arginine dibasic convertase), N-arginine dibasic convertase, NRD convertase, NRD-C
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: NRDC
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LVNWFKAHRGPGSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCIIPITDIRAFT
Quantity: 100 μL
Research Discipline: Neuroscience
Gene ID (Entrez): 4898
Target Species: Human
Isotype: IgG