MASL1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258552-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP258552 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
MASL1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
Leucine Rich Repeat Containing 65, LRRC65, Malignant Fibrous Histiocytoma Amplified Sequence 1, Malignant Fibrous Histiocytoma-Amplified Sequence 1, Malignant Fibrous Histiocytoma-Amplified Sequence With Leucine-Rich Tandem, MFH-Amplified Sequences With Leucine-Rich Tandem Repeats 1, MFHAS1
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
9258
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
MFHAS1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RVGLWKIKDNPLIQPPYEVCMKGIPYIAAYQKELAHSQPAVQPRLKLLLMGHKAAGKTLLRHCLTEERVEGCPGGGDKEKCYPPSP
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- MASL1 Polyclonal specifically detects MASL1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: MASL1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Leucine Rich Repeat Containing 65, LRRC65, Malignant Fibrous Histiocytoma Amplified Sequence 1, Malignant Fibrous Histiocytoma-Amplified Sequence 1, Malignant Fibrous Histiocytoma-Amplified Sequence With Leucine-Rich Tandem, MFH-Amplified Sequences With Leucine-Rich Tandem Repeats 1, MFHAS1
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 9258
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: MFHAS1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RVGLWKIKDNPLIQPPYEVCMKGIPYIAAYQKELAHSQPAVQPRLKLLLMGHKAAGKTLLRHCLTEERVEGCPGGGDKEKCYPPSP
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: alpha-N-terminal Methyltransferase 1A/METTL11A
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: AD-003, alpha N-terminal protein methyltransferase 1A, C9orf32, chromosome 9 open reading frame 32, EC 2.1.1.-, methyltransferase like 11A, Methyltransferase-like protein 11A, NRMT, N-terminal RCC1 methyltransferase, NTM1A, NTMT1, X-Pro-Lys N-terminal protein methyltransferase 1A
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 28989
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: NTMT1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKT
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: AD-003, alpha N-terminal protein methyltransferase 1A, C9orf32, chromosome 9 open reading frame 32, EC 2.1.1.-, methyltransferase like 11A, Methyltransferase-like protein 11A, NRMT, N-terminal RCC1 methyltransferase, NTM1A, NTMT1, X-Pro-Lys N-terminal pro
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 28989
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.