NGFI-B alpha/Nur77/NR4A1 Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258600-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP258600 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
NGFI-B alpha/Nur77/NR4A1
Classification
Polyclonal
Dilution
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
Early response protein NAK1, GFRP1ST-59, growth factor-inducible nuclear protein N10, HMRNP10, hormone receptor, MGC9485, N10, NAK1, NAK-1, NGFIB, Nuclear hormone receptor NUR/77, nuclear receptor subfamily 4 group A member 1, nuclear receptor subfamily 4, group A, member 1, NUR77, Orphan nuclear receptor HMR, Orphan nuclear receptor TR3, steroid receptor TR3, Testicular receptor 3, TR3, TR3 orphan receptor
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
NR4A1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASG
Quantity
100 μL
Research Discipline
Apoptosis
Gene ID (Entrez)
3164
Target Species
Human
Isotype
IgG
Related Products
Description
- NGFI-B alpha/Nur77/NR4A1 Polyclonal specifically detects NGFI-B alpha/Nur77/NR4A1 in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: NGFI-B alpha/Nur77/NR4A1
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Early response protein NAK1, GFRP1ST-59, growth factor-inducible nuclear protein N10, HMRNP10, hormone receptor, MGC9485, N10, NAK1, NAK-1, NGFIB, Nuclear hormone receptor NUR/77, nuclear receptor subfamily 4 group A member 1, nuclear receptor subfamily 4, group A, member 1, NUR77, Orphan nuclear receptor HMR, Orphan nuclear receptor TR3, steroid receptor TR3, Testicular receptor 3, TR3, TR3 orphan receptor
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: NR4A1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASG
Quantity: 100 μL
Research Discipline: Apoptosis
Gene ID (Entrez): 3164
Target Species: Human
Isotype: IgG
Antigen: RAD54L2
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Androgen receptor-interacting protein 4, ARIP4, EC 3.6.1, EC 3.6.4.12, FLJ21396, FLJ22400, helicase ARIP4, KIAA0809HSPC325, RAD54-like 2 (S. cerevisiae), RAD54-like protein 2, SRISNF2L
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: RAD54L2
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EHGYPVSGGFAMPPVSLNHNLTTPFTSQAGENSLFMGSTPSYYQLSNLLADARLVFPVTTDPLVPAGPVSSSSTATSVTASNPSFMLNPSVPGIL
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 23132
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: Androgen receptor-interacting protein 4, ARIP4, EC 3.6.1, EC 3.6.4.12, FLJ21396, FLJ22400, helicase ARIP4, KIAA0809HSPC325, RAD54-like 2 (S. cerevisiae), RAD54-like protein 2, SRISNF2L
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 23132
Target Species: __
Isotype: __
