DOCK1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258639-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP258639 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
DOCK1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
180 kDa protein downstream of CRK, ced5, dedicator of cytokinesis 1, dedicator of cyto-kinesis 1, DOCK180dedicator of cytokinesis protein 1, DOwnstream of CrK
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
DOCK1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VRIMPSSLDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSLSSDSTPSRPGSDGFALEPLLPKKMHSRSQDKLDKDDLEKE
Quantity
100 μL
Research Discipline
Apoptosis
Gene ID (Entrez)
1793
Target Species
Human
Isotype
IgG
Related Products
Description
- DOCK1 Polyclonal specifically detects DOCK1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: DOCK1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: 180 kDa protein downstream of CRK, ced5, dedicator of cytokinesis 1, dedicator of cyto-kinesis 1, DOCK180dedicator of cytokinesis protein 1, DOwnstream of CrK
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: DOCK1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VRIMPSSLDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSLSSDSTPSRPGSDGFALEPLLPKKMHSRSQDKLDKDDLEKE
Quantity: 100 μL
Research Discipline: Apoptosis
Gene ID (Entrez): 1793
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: 180 kDa protein downstream of CRK, ced5, dedicator of cytokinesis 1, dedicator of cyto-kinesis 1, DOCK180dedicator of cytokinesis protein 1, DOwnstream of CrK
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 1793
Target Species: __
Isotype: __
Antigen: __
Classification: __
Dilution: __
Gene Alias: Ras-Like Protein Family Member 11A, RAS-Like, Family 11, Member A
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 387496
Target Species: __
Isotype: __