CEECAM1 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258669-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP258669 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
CEECAM1
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
CEECAM1, CerCAM, cerebral endothelial cell adhesion molecule 1, cerebral endothelial cell adhesion moleculeMGC149621, GLT25D3cerebral cell adhesion molecule, glycosyltransferase 25 domain containing 3, glycosyltransferase 25 family member 3, KIAA1502, MGC149620
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
51148
Target Species
Human
Isotype
IgG
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
CERCAM
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FDQHPNEQYKAHFWPRDLVAFSAQPLLAAPTHYAGDAEWLSDTETSSPWDDD
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- CEECAM1 Polyclonal specifically detects CEECAM1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: CEECAM1
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: CEECAM1, CerCAM, cerebral endothelial cell adhesion molecule 1, cerebral endothelial cell adhesion moleculeMGC149621, GLT25D3cerebral cell adhesion molecule, glycosyltransferase 25 domain containing 3, glycosyltransferase 25 family member 3, KIAA1502, MGC149620
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 51148
Target Species: Human
Isotype: IgG
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: CERCAM
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FDQHPNEQYKAHFWPRDLVAFSAQPLLAAPTHYAGDAEWLSDTETSSPWDDD
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: CEECAM1, CerCAM, cerebral endothelial cell adhesion molecule 1, cerebral endothelial cell adhesion moleculeMGC149621, GLT25D3cerebral cell adhesion molecule, glycosyltransferase 25 domain containing 3, glycosyltransferase 25 family member 3, KIAA1502, MGC
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Gene ID (Entrez): 51148
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Antigen: C9orf9
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: chromosome 9 open reading frame 9, FLJ26879, Rsb-66 protein
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 11092
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: C9ORF9
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IAHSEKLPRKVLQHVSEPQAHQESTRGAARPAQAIGTQPRATKHKCRQLTKASLKPRGCSKPPWRPPGGKL
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.