OCT6 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258689-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP258689 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
OCT6
Classification
Polyclonal
Dilution
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias
Oct-6, OCT6POU domain transcription factor SCIP, Octamer-binding protein 6, Octamer-binding transcription factor 6, OTF6, OTF-6, POU class 3 homeobox 1, POU domain class 3, transcription factor 1, POU domain, class 3, transcription factor 1, SCIP
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
POU3F1
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LHHALHEDGHEAQLEPSPPPHLGAHGHAHGHAHAG
Quantity
100 μL
Research Discipline
Cellular Markers
Gene ID (Entrez)
5453
Target Species
Human
Isotype
IgG
Related Products
Description
- 44475 Polyclonal specifically detects 44475 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: OCT6
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: Oct-6, OCT6POU domain transcription factor SCIP, Octamer-binding protein 6, Octamer-binding transcription factor 6, OTF6, OTF-6, POU class 3 homeobox 1, POU domain class 3, transcription factor 1, POU domain, class 3, transcription factor 1, SCIP
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: POU3F1
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LHHALHEDGHEAQLEPSPPPHLGAHGHAHGHAHAG
Quantity: 100 μL
Research Discipline: Cellular Markers
Gene ID (Entrez): 5453
Target Species: Human
Isotype: IgG
Antigen: __
Classification: __
Dilution: __
Gene Alias: Oct-6, OCT6POU domain transcription factor SCIP, Octamer-binding protein 6, Octamer-binding transcription factor 6, OTF6, OTF-6, POU class 3 homeobox 1, POU domain class 3, transcription factor 1, POU domain, class 3, transcription factor 1, SCIP
Host Species: __
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: __
Quantity: 100μL
Research Discipline: __
Gene ID (Entrez): 5453
Target Species: __
Isotype: __
Antigen: ZNF642
Classification: Polyclonal
Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias: zinc finger protein 642
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: ZFP69
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MRDVRQAILTHKKRVQETNKFGENIIVHSNVIIEQRHHKYDTPTKRNTYKLDLINHPTSYIRTKTYECNICE
Quantity: 100 μL
Research Discipline: __
Gene ID (Entrez): 339559
Target Species: Human
Isotype: IgG