NF-L Antibody (CL4729), Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP259061-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP259061 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
NF-L
Classification
Monoclonal
Dilution
Western Blot 1 μg/mL, Immunohistochemistry 1:10000 - 1:20000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:10000 - 1:20000
Gene Alias
68 kDa neurofilament protein, neurofilament protein, light chain, neurofilament subunit NF-L, Neurofilament triplet L protein, neurofilament, light polypeptide, neurofilament-light, NF68FLJ53642, NF-L, NFLlight polypeptide 68kDa
Host Species
Mouse
Purification Method
Protein A purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of human NF-L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype
IgG1
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
NEFL
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRF
Quantity
100 μL
Research Discipline
Autophagy, Cellular Markers, Cytoskeleton Markers, Neurodegeneration, Neurofilaments, Neuronal Cell Markers, Neuroscience
Gene ID (Entrez)
4747
Target Species
Human, Mouse, Rat
Form
Purified
Related Products
Description
- NF-L Monoclonal specifically detects NF-L in Human, Mouse, Rat samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: NF-L
Classification: Monoclonal
Dilution: Western Blot 1 μg/mL, Immunohistochemistry 1:10000 - 1:20000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:10000 - 1:20000
Gene Alias: 68 kDa neurofilament protein, neurofilament protein, light chain, neurofilament subunit NF-L, Neurofilament triplet L protein, neurofilament, light polypeptide, neurofilament-light, NF68FLJ53642, NF-L, NFLlight polypeptide 68kDa
Host Species: Mouse
Purification Method: Protein A purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of human NF-L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG1
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: NEFL
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRF
Quantity: 100 μL
Research Discipline: Autophagy, Cellular Markers, Cytoskeleton Markers, Neurodegeneration, Neurofilaments, Neuronal Cell Markers, Neuroscience
Gene ID (Entrez): 4747
Target Species: Human, Mouse, Rat
Form: Purified
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: __
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: __
Isotype: __
Applications: __
Conjugate: __
Formulation: __
Gene Symbols: __
Immunogen: __
Quantity: 5
Research Discipline: __
Gene ID (Entrez): __
Target Species: __
Form: __
Antigen: CIITA
Classification: Polyclonal
Dilution: Western Blot 1-2 ug/ml, ELISA 1:100-1:2000, Immunocytochemistry/Immunofluorescence 20 ug/ml, Immunohistochemistry-Paraffin 1:10-1:500, Immunohistochemistry-Frozen 1:10-1:500, Methylated DNA Immunoprecipitation 1:10-1:1000
Gene Alias: C2TA, C2TAMHC class II transactivator type III, CIITAIV, class II, major histocompatibility complex, transactivator, MHC class II transactivator, MHC2TANLR family, acid domain containing, NLRA, nucleotide-binding oligomerization domain, leucine rich repeat and acid domaincontaining
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: __
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG
Applications: Western Blot, ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
Conjugate: Unconjugated
Formulation: PBS with 0.02% Sodium Azide
Gene Symbols: CIITA
Immunogen: Antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human CIITA. The immunogen is located within amino acids 120 - 170 of CIITA.
Quantity: 0.1 mg
Research Discipline: __
Gene ID (Entrez): 4261
Target Species: Human, Mouse, Rat
Form: __