POU3F2/OCT7 Antibody (CL6232), Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP261437-Each-of-1 | In Stock | ₹ 55,271.76 |
NBP261437 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 55,271.76
GST (18%): ₹ 9,948.917
Total Price: ₹ 65,220.677
Antigen
POU3F2/OCT7
Classification
Monoclonal
Conjugate
Unconjugated
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols
POU3F2
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHP
Quantity
100 μL
Primary or Secondary
Primary
Test Specificity
Specificity of human POU3F2/OCT7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype
IgG1
Applications
Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clone
CL6232
Dilution
Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias
Brain-2, Brain-specific homeobox/POU domain protein 2, brn-2, BRN2brain-2, Nervous system-specific octamer-binding transcription factor N-Oct-3, Oct-7, OCT7POU domain class 3, transcription factor 2, Octamer-binding protein 7, Octamer-binding transcription factor 7, OTF7, OTF-7, POU class 3 homeobox 2, POU domain, class 3, transcription factor 2, POUF3
Host Species
Mouse
Purification Method
Protein A purified
Research Discipline
Transcription Factors and Regulators
Gene ID (Entrez)
5454
Target Species
Human, Mouse, Rat
Form
Purified
Related Products
Description
- POU3F2/OCT7 Monoclonal specifically detects POU3F2/OCT7 in Human, Mouse, Rat samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: POU3F2/OCT7
Classification: Monoclonal
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: POU3F2
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHP
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of human POU3F2/OCT7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG1
Applications: Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Clone: CL6232
Dilution: Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias: Brain-2, Brain-specific homeobox/POU domain protein 2, brn-2, BRN2brain-2, Nervous system-specific octamer-binding transcription factor N-Oct-3, Oct-7, OCT7POU domain class 3, transcription factor 2, Octamer-binding protein 7, Octamer-binding transcription factor 7, OTF7, OTF-7, POU class 3 homeobox 2, POU domain, class 3, transcription factor 2, POUF3
Host Species: Mouse
Purification Method: Protein A purified
Research Discipline: Transcription Factors and Regulators
Gene ID (Entrez): 5454
Target Species: Human, Mouse, Rat
Form: Purified
Antigen: T-box 19
Classification: Monoclonal
Conjugate: Unconjugated
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols: TBX19
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVSTWTAVASHPFAGWGGPGAGGHHSPSSLDG
Quantity: 100 μL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG1
Applications: Immunohistochemistry (Paraffin)
Clone: CL6251
Dilution: Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias: dJ747L4.1, FLJ26302, FLJ34085, T-box 19, T-box factor, pituitary, T-box protein 19, T-box transcription factor TBX19, TBS 19, TBS19, TPITFLJ34543
Host Species: Mouse
Purification Method: Protein A purified
Research Discipline: __
Gene ID (Entrez): 9095
Target Species: Human
Form: Purified
Antigen: Yersinia Pestis F1 deficient Antigen
Classification: Monoclonal
Conjugate: Unconjugated
Formulation: PBS with 0.02% Sodium Azide
Gene Symbols: __
Immunogen: Formalin-killed F1 antigen-deficient Yersinia pestis A1122 cells
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: __
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype: IgG1
Applications: __
Clone: 6B5
Dilution: N/A
Gene Alias: Bacille de la peste, Bacterium pestis, fraction 1 antigen, Pasteurella pestis
Host Species: Mouse
Purification Method: Protein A purified
Research Discipline: Virology Bacteria and Parasites
Gene ID (Entrez): __
Target Species: Bacteria
Form: Purified
