Manufacturer: Novus Biologicals
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NP197692A32-Each-of-1 | In Stock | ₹ 59,630.00 |
NP197692A32 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 59,630.00
GST (18%): ₹ 10,733.40
Total Price: ₹ 70,363.40
Integrin alpha 3/CD49c
Monoclonal
Alexa Fluor 532
50 mM sodium borate with 0.05% sodium azide
ITGA3
Clone 29A3 is a mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
0.1 mL
3675.0
Human, Porcine
IgG1
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen)
29A3
Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen
antigen identified by monoclonal J143, CD49 antigen-like family member C, CD49c, CD49c antigen, FLJ34631, FLJ34704, FRP-2, Galactoprotein B3, GAP-B3, GAPB3CD49C, integrin alpha-3, integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor), MSK18, VCA-2, very late activation protein 3 receptor, alpha-3 subunit, VL3A, VLA-3 subunit alpha, VLA3a
Mouse
Protein A or G purified
Primary
29A3 recognizes specifically the cytoplasmic domain of integrin subunit alpha3A. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.
Store at 4°C in the dark.