Integrin alpha 3B Antibody (54B3), Alexa Fluor™ 594, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NP197732A94-Each-of-1 | In Stock | ₹ 57,325.20 |
NP197732A94 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 57,325.20
GST (18%): ₹ 10,318.536
Total Price: ₹ 67,643.736
Antigen
Integrin alpha 3B
Classification
Monoclonal
Conjugate
Alexa Fluor 594
Formulation
50 mM sodium borate with 0.05% sodium azide
Gene Symbols
ITGA3
Immunogen
Clone 54B3 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.
Quantity
0.1 mL
Gene ID (Entrez)
3675.0
Target Species
Human
Isotype
IgG1
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen)
Clone
54B3
Dilution
Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen
Gene Alias
AA407068, CD49C, GAPB3, integrin alpha 3
Host Species
Mouse
Purification Method
Protein A or G purified
Primary or Secondary
Primary
Test Specificity
54B3 recognizes specifically the cytoplasmic domain of integrin subunit alpha3B. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.
Content And Storage
Store at 4°C in the dark.
Related Products
Description
- Description Integrin alpha 3B Monoclonal specifically detects Integrin alpha 3B in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen.
Compare Similar Items
Show Difference
Antigen: Integrin alpha 3B
Classification: Monoclonal
Conjugate: Alexa Fluor 594
Formulation: 50 mM sodium borate with 0.05% sodium azide
Gene Symbols: ITGA3
Immunogen: Clone 54B3 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.
Quantity: 0.1 mL
Gene ID (Entrez): 3675.0
Target Species: Human
Isotype: IgG1
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen)
Clone: 54B3
Dilution: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen
Gene Alias: AA407068, CD49C, GAPB3, integrin alpha 3
Host Species: Mouse
Purification Method: Protein A or G purified
Primary or Secondary: Primary
Test Specificity: 54B3 recognizes specifically the cytoplasmic domain of integrin subunit alpha3B. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.
Content And Storage: Store at 4°C in the dark.
Antigen: Integrin beta 1D
Classification: Monoclonal
Conjugate: Alexa Fluor 594
Formulation: 50 mM sodium borate with 0.05% sodium azide
Gene Symbols: ITGB1
Immunogen: Clone 1G2 is a mouse monoclonal IgG2a, kappa antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a mouse immunized with a synthetic peptide corresponding to the Cterminal 24 amino acids of integrin beta1D including an appending N-terminal cysteine (CQENPIYKSPINNFKNPNYGRKAGL) coupled to keyhole limpet hemocyanin.
Quantity: 0.1 mL
Gene ID (Entrez): 3688.0
Target Species: Human, Mouse
Isotype: IgG2a
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen)
Clone: 1G2
Dilution: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen
Gene Alias: integrin beta-1, CD29, FNRB, GPIIA, integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12), MDF2, MSK12, VLAB, VLA-BETA
Host Species: Mouse
Purification Method: Protein A or G purified
Primary or Secondary: Primary
Test Specificity: 1G2 recognizes specifically the cytoplasmic domain of integrin subunit beta 1D present in cardiac and skeletal muscle.
Content And Storage: Store at 4°C in the dark.
Antigen: PIF1
Classification: Polyclonal
Conjugate: Alexa Fluor 350
Formulation: 50 mM sodium borate with 0.05% sodium azide
Gene Symbols: PIF1
Immunogen: A synthetic peptide made to an internal portion of the human PIF1 protein (between residues 400-500) [UniProt Q9H611]
Quantity: 0.1 mL
Gene ID (Entrez): 80119
Target Species: Mouse
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Clone: __
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin
Gene Alias: C15orf20, PIF, PIF1 5-to-3 Prime DNA helicase homolog, RRM3 DNA helicase-like protein
Host Species: Rabbit
Purification Method: __
Primary or Secondary: Primary
Test Specificity: __
Content And Storage: Store at 4°C in the dark.