Protocadherin Gamma Monoclonal Antibody (S159-5), FITC, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIMA545659-Each-of-1 | In Stock | ₹ 38,758.68 |
PIMA545659 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 38,758.68
GST (18%): ₹ 6,976.562
Total Price: ₹ 45,735.242
Antigen
Protocadherin Gamma
Classification
Monoclonal
Concentration
1 mg/mL
Formulation
9.1mM sodium bicarbonate, 9.44mM PBS with 123mM ethanolamine, 581mM DMSO and no preservative; pH 7.4
Gene Accession No.
O60330, Q91XY4, Q9UN70, Q9UN71, Q9Y5F6, Q9Y5F7, Q9Y5F8, Q9Y5F9, Q9Y5G0, Q9Y5G1, Q9Y5G2, Q9Y5G3, Q9Y5G4, Q9Y5G5, Q9Y5G6, Q9Y5G7, Q9Y5G8, Q9Y5G9, Q9Y5H0, Q9Y5H1, Q9Y5H2, Q9Y5H3, Q9Y5H4
Gene Symbols
Pcdhga1, Pcdhga10, Pcdhga11, PCDHGA12, Pcdhga2, PCDHGA3, PCDHGA4, Pcdhga5, PCDHGA6, Pcdhga7, PCDHGA8, Pcdhga9, PCDHGB1, PCDHGB2, PCDHGB3, Pcdhgb4, Pcdhgb5, Pcdhgb6, Pcdhgb7, Pcdhgc3, PCDHGC4, PCDHGC5
Immunogen
Fusion protein corresponding to amino acids 808-931 (C-terminal cytoplasmic constant domain) of mouse Protocadherin-gamma-A1 that is shared by all 22 Gamma-protocadherins (A subfamily amino acids ∽807-930, B subfamily amino acids ∽789-912 and C subfamily amino acids ∽818-941).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Form
Liquid
Applications
Immunocytochemistry, Immunohistochemistry, Western Blot
Clone
S159-5
Conjugate
FITC
Gene
PCDHGA12
Gene Alias
3' RACE product; cadherin 20; cadherin 21; cadherin ME3; cadherin ME6; cadherin-20; Cadherin-21; cadherin-like 2; CDH20; CDH21; CDH-GAMMA-A5; FIB2; FIB3; fibroblast cadherin FIB2; fibroblast cadherin FIB3; fibroblast cadherin-2; Fibroblast cadherin-3; KIAA0327; KIAA0588; ME3; ME6; mKIAA0588; mKIAA4054; Pan-Gamma-Protocadherin-A; pc2c; PC43; PC-43; PCDH gamma A; Pcdh13; PCDH2; PCDHGA; PCDHGA1; PCDHGA10; PCDHGA11; PCDHGA12; Pcdhga2; PCDHGA3; Pcdhga4; PCDHGA5; PCDHGA6; PCDHGA7; Pcdhga8; PCDHGA9; PCDH-gamma-A; PCDH-GAMMA-A1; PCDH-gamma-A10; PCDH-GAMMA-A11; PCDH-gamma-A12; PCDH-GAMMA-A2; PCDH-gamma-A3; PCDH-gamma-A4; PCDH-GAMMA-A5; PCDH-gamma-A6; PCDH-GAMMA-A7; PCDH-gamma-A8; PCDH-gamma-A9; PCDH-GAMMA-B1; PCDH-GAMMA-B2; PCDH-gamma-B3; PCDH-GAMMA-B4; PCDH-GAMMA-B5; PCDH-GAMMA-B6; PCDH-gamma-B7; PCDH-GAMMA-C3; PCDH-gamma-C4; PCDH-gamma-C5; Pcdhgb1; PCDHGB2; PCDHGB3; PCDHGB4; PCDHGB5; Pcdhgb6; Pcdhgb7; PCDHGC3; Pcdhgc4; PCDHGC5; protocadherin 13; protocadherin 2; protocadherin 43; protocadherin gamma A12; protocadherin gamma B2; protocadherin gamma B6; protocadherin gamma C-VI; protocadherin gamma subfamily A, 1; protocadherin gamma subfamily A, 10; protocadherin gamma subfamily A, 11; protocadherin gamma subfamily A, 12; protocadherin gamma subfamily A, 2; protocadherin gamma subfamily A, 3; protocadherin gamma subfamily A, 4; protocadherin gamma subfamily A, 5; protocadherin gamma subfamily A, 6; protocadherin gamma subfamily A, 7; protocadherin gamma subfamily A, 8; protocadherin gamma subfamily A, 9; protocadherin gamma subfamily B, 1; protocadherin gamma subfamily B, 1, isoform 2; protocadherin gamma subfamily B, 2; protocadherin gamma subfamily B, 3; protocadherin gamma subfamily B, 4; protocadherin gamma subfamily B, 5; protocadherin gamma subfamily B, 6; protocadherin gamma subfamily B, 7; protocadherin gamma subfamily C, 3; protocadherin gamma subfamily C, 4; protocadherin gamma subfamily C, 5; protocadherin gamma-A1; Protocadherin gamma-A10; protocadherin gamma-A11; Protocadherin gamma-A12; protocadherin gamma-A2; Protocadherin gamma-A3; protocadherin gamma-A4; Protocadherin gamma-A5; protocadherin gamma-A6; Protocadherin gamma-A7; protocadherin gamma-A8; Protocadherin gamma-A9; protocadherin gamma-B1; Protocadherin gamma-B2; protocadherin gamma-B3; Protocadherin gamma-B4; protocadherin gamma-B5; Protocadherin gamma-B6; protocadherin gamma-B7; Protocadherin gamma-C3; protocadherin gamma-C4; Protocadherin gamma-C5; protocadherin-2; Protocadherin-43; UNQ371/PRO707
Host Species
Mouse
Purification Method
Protein G
Regulatory Status
RUO
Gene ID (Entrez)
102552497, 102552705, 102552796, 116782, 252894, 252895, 252897, 26025, 291635, 291637, 364843, 364844, 498846, 498847, 498849, 498850, 5098, 553129, 56097, 56098, 56099, 56100, 56101, 56102, 56103, 56104, 56105, 56106, 56107, 56108, 56109, 56110, 56111, 56112, 56113, 56114, 641525, 641526, 680361, 680448, 8641, 93699, 93700, 93701, 93702, 93703, 93704, 93706, 93707, 93708, 93709, 93710, 93711, 93712, 93713, 93714, 93715, 93716, 93717, 93722, 93723, 93724, 9708
Content And Storage
4° C, store in dark
Isotype
IgG1
Related Products
Description
- 1 μg/mL of MA5-45659 was sufficient for detection of Protocadherin gamma (pan) in 20 μg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.∣Detects approximately 100kDa
- Cross-reacts with all Gamma-protocadherin-A, -B and -C proteins
- The protocadherin gamma gene cluster is one of three related clusters tandemly linked on chromosome five
- These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression
- The gamma gene cluster includes 22 genes divided into 3 subfamilies
- Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes
- The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster
- Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region
- The constant region exons encode the common cytoplasmic region
- These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain
- Alternative splicing has been described for the gamma cluster genes.
Compare Similar Items
Show Difference
Antigen: Protocadherin Gamma
Classification: Monoclonal
Concentration: 1 mg/mL
Formulation: 9.1mM sodium bicarbonate, 9.44mM PBS with 123mM ethanolamine, 581mM DMSO and no preservative; pH 7.4
Gene Accession No.: O60330, Q91XY4, Q9UN70, Q9UN71, Q9Y5F6, Q9Y5F7, Q9Y5F8, Q9Y5F9, Q9Y5G0, Q9Y5G1, Q9Y5G2, Q9Y5G3, Q9Y5G4, Q9Y5G5, Q9Y5G6, Q9Y5G7, Q9Y5G8, Q9Y5G9, Q9Y5H0, Q9Y5H1, Q9Y5H2, Q9Y5H3, Q9Y5H4
Gene Symbols: Pcdhga1, Pcdhga10, Pcdhga11, PCDHGA12, Pcdhga2, PCDHGA3, PCDHGA4, Pcdhga5, PCDHGA6, Pcdhga7, PCDHGA8, Pcdhga9, PCDHGB1, PCDHGB2, PCDHGB3, Pcdhgb4, Pcdhgb5, Pcdhgb6, Pcdhgb7, Pcdhgc3, PCDHGC4, PCDHGC5
Immunogen: Fusion protein corresponding to amino acids 808-931 (C-terminal cytoplasmic constant domain) of mouse Protocadherin-gamma-A1 that is shared by all 22 Gamma-protocadherins (A subfamily amino acids ∽807-930, B subfamily amino acids ∽789-912 and C subfamily amino acids ∽818-941).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Form: Liquid
Applications: Immunocytochemistry, Immunohistochemistry, Western Blot
Clone: S159-5
Conjugate: FITC
Gene: PCDHGA12
Gene Alias: 3' RACE product; cadherin 20; cadherin 21; cadherin ME3; cadherin ME6; cadherin-20; Cadherin-21; cadherin-like 2; CDH20; CDH21; CDH-GAMMA-A5; FIB2; FIB3; fibroblast cadherin FIB2; fibroblast cadherin FIB3; fibroblast cadherin-2; Fibroblast cadherin-3; KIAA0327; KIAA0588; ME3; ME6; mKIAA0588; mKIAA4054; Pan-Gamma-Protocadherin-A; pc2c; PC43; PC-43; PCDH gamma A; Pcdh13; PCDH2; PCDHGA; PCDHGA1; PCDHGA10; PCDHGA11; PCDHGA12; Pcdhga2; PCDHGA3; Pcdhga4; PCDHGA5; PCDHGA6; PCDHGA7; Pcdhga8; PCDHGA9; PCDH-gamma-A; PCDH-GAMMA-A1; PCDH-gamma-A10; PCDH-GAMMA-A11; PCDH-gamma-A12; PCDH-GAMMA-A2; PCDH-gamma-A3; PCDH-gamma-A4; PCDH-GAMMA-A5; PCDH-gamma-A6; PCDH-GAMMA-A7; PCDH-gamma-A8; PCDH-gamma-A9; PCDH-GAMMA-B1; PCDH-GAMMA-B2; PCDH-gamma-B3; PCDH-GAMMA-B4; PCDH-GAMMA-B5; PCDH-GAMMA-B6; PCDH-gamma-B7; PCDH-GAMMA-C3; PCDH-gamma-C4; PCDH-gamma-C5; Pcdhgb1; PCDHGB2; PCDHGB3; PCDHGB4; PCDHGB5; Pcdhgb6; Pcdhgb7; PCDHGC3; Pcdhgc4; PCDHGC5; protocadherin 13; protocadherin 2; protocadherin 43; protocadherin gamma A12; protocadherin gamma B2; protocadherin gamma B6; protocadherin gamma C-VI; protocadherin gamma subfamily A, 1; protocadherin gamma subfamily A, 10; protocadherin gamma subfamily A, 11; protocadherin gamma subfamily A, 12; protocadherin gamma subfamily A, 2; protocadherin gamma subfamily A, 3; protocadherin gamma subfamily A, 4; protocadherin gamma subfamily A, 5; protocadherin gamma subfamily A, 6; protocadherin gamma subfamily A, 7; protocadherin gamma subfamily A, 8; protocadherin gamma subfamily A, 9; protocadherin gamma subfamily B, 1; protocadherin gamma subfamily B, 1, isoform 2; protocadherin gamma subfamily B, 2; protocadherin gamma subfamily B, 3; protocadherin gamma subfamily B, 4; protocadherin gamma subfamily B, 5; protocadherin gamma subfamily B, 6; protocadherin gamma subfamily B, 7; protocadherin gamma subfamily C, 3; protocadherin gamma subfamily C, 4; protocadherin gamma subfamily C, 5; protocadherin gamma-A1; Protocadherin gamma-A10; protocadherin gamma-A11; Protocadherin gamma-A12; protocadherin gamma-A2; Protocadherin gamma-A3; protocadherin gamma-A4; Protocadherin gamma-A5; protocadherin gamma-A6; Protocadherin gamma-A7; protocadherin gamma-A8; Protocadherin gamma-A9; protocadherin gamma-B1; Protocadherin gamma-B2; protocadherin gamma-B3; Protocadherin gamma-B4; protocadherin gamma-B5; Protocadherin gamma-B6; protocadherin gamma-B7; Protocadherin gamma-C3; protocadherin gamma-C4; Protocadherin gamma-C5; protocadherin-2; Protocadherin-43; UNQ371/PRO707
Host Species: Mouse
Purification Method: Protein G
Regulatory Status: RUO
Gene ID (Entrez): 102552497, 102552705, 102552796, 116782, 252894, 252895, 252897, 26025, 291635, 291637, 364843, 364844, 498846, 498847, 498849, 498850, 5098, 553129, 56097, 56098, 56099, 56100, 56101, 56102, 56103, 56104, 56105, 56106, 56107, 56108, 56109, 56110, 56111, 56112, 56113, 56114, 641525, 641526, 680361, 680448, 8641, 93699, 93700, 93701, 93702, 93703, 93704, 93706, 93707, 93708, 93709, 93710, 93711, 93712, 93713, 93714, 93715, 93716, 93717, 93722, 93723, 93724, 9708
Content And Storage: 4° C, store in dark
Isotype: IgG1
Antigen: Protocadherin Gamma
Classification: Monoclonal
Concentration: 1 mg/mL
Formulation: 2.15mM MES, 47.35mM phosphate with 1.033mM EDTA and no preservative; pH 7.4
Gene Accession No.: O60330, Q91XY4, Q9UN70, Q9UN71, Q9Y5F6, Q9Y5F7, Q9Y5F8, Q9Y5F9, Q9Y5G0, Q9Y5G1, Q9Y5G2, Q9Y5G3, Q9Y5G4, Q9Y5G5, Q9Y5G6, Q9Y5G7, Q9Y5G8, Q9Y5G9, Q9Y5H0, Q9Y5H1, Q9Y5H2, Q9Y5H3, Q9Y5H4
Gene Symbols: Pcdhga1, Pcdhga10, Pcdhga11, PCDHGA12, Pcdhga2, PCDHGA3, PCDHGA4, Pcdhga5, PCDHGA6, Pcdhga7, PCDHGA8, Pcdhga9, PCDHGB1, PCDHGB2, PCDHGB3, Pcdhgb4, Pcdhgb5, Pcdhgb6, Pcdhgb7, Pcdhgc3, PCDHGC4, PCDHGC5
Immunogen: Fusion protein corresponding to amino acids 808-931 (C-terminal cytoplasmic constant domain) of mouse Protocadherin-gamma-A1 that is shared by all 22 Gamma-protocadherins (A subfamily amino acids ∽807-930, B subfamily amino acids ∽789-912 and C subfamily amino acids ∽818-941).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Form: Liquid
Applications: Immunocytochemistry, Immunohistochemistry, Western Blot
Clone: S159-5
Conjugate: PerCP
Gene: PCDHGA12
Gene Alias: 3' RACE product; cadherin 20; cadherin 21; cadherin ME3; cadherin ME6; cadherin-20; Cadherin-21; cadherin-like 2; CDH20; CDH21; CDH-GAMMA-A5; FIB2; FIB3; fibroblast cadherin FIB2; fibroblast cadherin FIB3; fibroblast cadherin-2; Fibroblast cadherin-3; KIAA0327; KIAA0588; ME3; ME6; mKIAA0588; mKIAA4054; Pan-Gamma-Protocadherin-A; pc2c; PC43; PC-43; PCDH gamma A; Pcdh13; PCDH2; PCDHGA; PCDHGA1; PCDHGA10; PCDHGA11; PCDHGA12; Pcdhga2; PCDHGA3; Pcdhga4; PCDHGA5; PCDHGA6; PCDHGA7; Pcdhga8; PCDHGA9; PCDH-gamma-A; PCDH-GAMMA-A1; PCDH-gamma-A10; PCDH-GAMMA-A11; PCDH-gamma-A12; PCDH-GAMMA-A2; PCDH-gamma-A3; PCDH-gamma-A4; PCDH-GAMMA-A5; PCDH-gamma-A6; PCDH-GAMMA-A7; PCDH-gamma-A8; PCDH-gamma-A9; PCDH-GAMMA-B1; PCDH-GAMMA-B2; PCDH-gamma-B3; PCDH-GAMMA-B4; PCDH-GAMMA-B5; PCDH-GAMMA-B6; PCDH-gamma-B7; PCDH-GAMMA-C3; PCDH-gamma-C4; PCDH-gamma-C5; Pcdhgb1; PCDHGB2; PCDHGB3; PCDHGB4; PCDHGB5; Pcdhgb6; Pcdhgb7; PCDHGC3; Pcdhgc4; PCDHGC5; protocadherin 13; protocadherin 2; protocadherin 43; protocadherin gamma A12; protocadherin gamma B2; protocadherin gamma B6; protocadherin gamma C-VI; protocadherin gamma subfamily A, 1; protocadherin gamma subfamily A, 10; protocadherin gamma subfamily A, 11; protocadherin gamma subfamily A, 12; protocadherin gamma subfamily A, 2; protocadherin gamma subfamily A, 3; protocadherin gamma subfamily A, 4; protocadherin gamma subfamily A, 5; protocadherin gamma subfamily A, 6; protocadherin gamma subfamily A, 7; protocadherin gamma subfamily A, 8; protocadherin gamma subfamily A, 9; protocadherin gamma subfamily B, 1; protocadherin gamma subfamily B, 1, isoform 2; protocadherin gamma subfamily B, 2; protocadherin gamma subfamily B, 3; protocadherin gamma subfamily B, 4; protocadherin gamma subfamily B, 5; protocadherin gamma subfamily B, 6; protocadherin gamma subfamily B, 7; protocadherin gamma subfamily C, 3; protocadherin gamma subfamily C, 4; protocadherin gamma subfamily C, 5; protocadherin gamma-A1; Protocadherin gamma-A10; protocadherin gamma-A11; Protocadherin gamma-A12; protocadherin gamma-A2; Protocadherin gamma-A3; protocadherin gamma-A4; Protocadherin gamma-A5; protocadherin gamma-A6; Protocadherin gamma-A7; protocadherin gamma-A8; Protocadherin gamma-A9; protocadherin gamma-B1; Protocadherin gamma-B2; protocadherin gamma-B3; Protocadherin gamma-B4; protocadherin gamma-B5; Protocadherin gamma-B6; protocadherin gamma-B7; Protocadherin gamma-C3; protocadherin gamma-C4; Protocadherin gamma-C5; protocadherin-2; Protocadherin-43; UNQ371/PRO707
Host Species: Mouse
Purification Method: Protein G
Regulatory Status: RUO
Gene ID (Entrez): 102552497, 102552705, 102552796, 116782, 252894, 252895, 252897, 26025, 291635, 291637, 364843, 364844, 498846, 498847, 498849, 498850, 5098, 553129, 56097, 56098, 56099, 56100, 56101, 56102, 56103, 56104, 56105, 56106, 56107, 56108, 56109, 56110, 56111, 56112, 56113, 56114, 641525, 641526, 680361, 680448, 8641, 93699, 93700, 93701, 93702, 93703, 93704, 93706, 93707, 93708, 93709, 93710, 93711, 93712, 93713, 93714, 93715, 93716, 93717, 93722, 93723, 93724, 9708
Content And Storage: 4° C
Isotype: IgG1
Antigen: Ataxin 1
Classification: Monoclonal
Concentration: 1 mg/mL
Formulation: 2.15mM MES, 47.35mM phosphate with 1.033mM EDTA and no preservative; pH 7.4
Gene Accession No.: P54253, P54254, Q63540
Gene Symbols: ATXN1
Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1.
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Form: Liquid
Applications: Immunocytochemistry, Immunohistochemistry, Immunoprecipitation, Western Blot
Clone: S76-8
Conjugate: APC
Gene: ATXN1
Gene Alias: 2900016G23Rik; alternative ataxin1; ataxin 1; Ataxin1; ataxin-1; Atx1; Atx-1; Atx-1-PB; Atxn1; C85907; CG4547; CG4547-PB; D6S504E; dAtx-1; Dmel\CG4547; Dmel_CG4547; ENSMUSG00000074917; Gm10786; OTTHUMP00000016065; SCA1; spinocerebellar ataxia 1; spinocerebellar ataxia 1 homolog; spinocerebellar ataxia type 1 protein; Spinocerebellar ataxia type 1 protein homolog
Host Species: Mouse
Purification Method: Protein G
Regulatory Status: RUO
Gene ID (Entrez): 20238, 25049, 6310
Content And Storage: 4° C
Isotype: IgG2b