RAGE Monoclonal Antibody (5C6C1), Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIMA549253-Each-of-1 | In Stock | ₹ 34,908.48 |
PIMA549253 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 34,908.48
GST (18%): ₹ 6,283.526
Total Price: ₹ 41,192.006
Antigen
RAGE
Classification
Monoclonal
Concentration
500 μg/mL
Formulation
PBS with 4MG trehalose and no preservative
Gene Accession No.
Q15109, Q62151, Q63495
Gene Symbols
AGER
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Form
Lyophilized
Applications
Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
Clone
5C6C1
Conjugate
Unconjugated
Gene
AGER
Gene Alias
advanced glycation end product receptor; advanced glycation end-product receptor; advanced glycation end-products receptor; advanced glycosylation end product-specific receptor; advanced glycosylation end product-specific receptor variant 2; advanced glycosylation end product-specific receptor variant 3; advanced glycosylation end product-specific receptor variant 4; advanced glycosylation end product-specific receptor variant 5; advanced glycosylation end-product specific receptor; Ager; MAPK/MAK/MRK overlapping kinase; MOK; MOK protein kinase; RAGE; RAGE isoform NtRAGE-delta; RAGE isoform sRAGE-delta; RAGE/AGER; RAGE1; RAGE-1; RAGE-4 ORF3; receptor for advanced glycation endproducts; receptor for advanced glycation end-products variant 20; receptor for advanced glycosylation end products; receptor of advanced glycosylation end products of proteins; immunoglobulin superfamily; MHC class II; MHC class III; renal cell carcinoma antigen; renal tumor antigen 1; SCARJ1; sRAGE; STK30
Host Species
Mouse
Purification Method
Antigen affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
11596, 177, 81722
Content And Storage
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Isotype
IgG2b
Related Products
Description
- Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL
- Immunogen sequence is different from the related mouse and rat sequences by six amino acids
- Able to phosphorylate several exogenous substrates and to undergo autophosphorylation.
Compare Similar Items
Show Difference
Antigen: RAGE
Classification: Monoclonal
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and no preservative
Gene Accession No.: Q15109, Q62151, Q63495
Gene Symbols: AGER
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Form: Lyophilized
Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
Clone: 5C6C1
Conjugate: Unconjugated
Gene: AGER
Gene Alias: advanced glycation end product receptor; advanced glycation end-product receptor; advanced glycation end-products receptor; advanced glycosylation end product-specific receptor; advanced glycosylation end product-specific receptor variant 2; advanced glycosylation end product-specific receptor variant 3; advanced glycosylation end product-specific receptor variant 4; advanced glycosylation end product-specific receptor variant 5; advanced glycosylation end-product specific receptor; Ager; MAPK/MAK/MRK overlapping kinase; MOK; MOK protein kinase; RAGE; RAGE isoform NtRAGE-delta; RAGE isoform sRAGE-delta; RAGE/AGER; RAGE1; RAGE-1; RAGE-4 ORF3; receptor for advanced glycation endproducts; receptor for advanced glycation end-products variant 20; receptor for advanced glycosylation end products; receptor of advanced glycosylation end products of proteins; immunoglobulin superfamily; MHC class II; MHC class III; renal cell carcinoma antigen; renal tumor antigen 1; SCARJ1; sRAGE; STK30
Host Species: Mouse
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 11596, 177, 81722
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Isotype: IgG2b
Antigen: ME1
Classification: Monoclonal
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and no preservative
Gene Accession No.: P06801, P13697, P48163
Gene Symbols: Me1
Immunogen: E.coli-derived human ME1 recombinant protein (Position: M1-Q572).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Form: Lyophilized
Applications: Immunohistochemistry (Paraffin), Western Blot
Clone: 5E5F7
Conjugate: Unconjugated
Gene: Me1
Gene Alias: cytosolic malic enzyme 1; D9Ertd267e; HUMNDME; malate dehydrogenase; malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+)); malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+); malate dehydrogenase decarboxylase (NADP+); malic enzyme; malic enzyme 1; malic enzyme 1, NADP(+)-dependent, cytoplasmic (cytosolic, soluble); malic enzyme 1, NADP(+)-dependent, cytosolic; malic enzyme 1, soluble; Malic enzyme, cytoplasmic; malic enzyme, supernatant; Mdh-1; ME1; MES; Mod1; Mod-1; NADP-dependent malic enzyme; NADP-dependent malic enzyme-like protein; NADP-ME; pyruvic-malic carboxylase
Host Species: Mouse
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 17436, 24552, 4199
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Isotype: IgG1
Antigen: RNF20
Classification: Monoclonal
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and no preservative
Gene Accession No.: Q5DTM8, Q5VTR2
Gene Symbols: RNF20
Immunogen: E.coli-derived human RNF20 recombinant protein (Position: E123-S389).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Form: Lyophilized
Applications: Western Blot
Clone: 3C6E2
Conjugate: Unconjugated
Gene: RNF20
Gene Alias: 4833430L21Rik; AW540162; BRE1; BRE1 E3 ubiquitin ligase homolog; BRE1A; BRE1-A; C79397; E3 ubiquitin-protein ligase BRE1A; FLJ11189; FLJ20382; hBRE1; HNF3B; homolog of S. cerevisiae BRE1; hypothetical protein; KIAA2779; Kiaa4116; MGC129667; MGC129668; mKIAA4116; RCJMB04_5a23; RING finger protein 20; ring finger protein 20, E3 ubiquitin protein ligase; RING-type E3 ubiquitin transferase BRE1A; Rnf20; TCF3B
Host Species: Mouse
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 109331, 313216, 56254
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Isotype: IgG2b
