SCN11A Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA5114378-Each-of-1 | In Stock | ₹ 44,705.10 |
PIPA5114378 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 44,705.10
GST (18%): ₹ 8,046.918
Total Price: ₹ 52,752.018
Antigen
SCN11A
Classification
Polyclonal
Conjugate
Unconjugated
Gene
SCN11A
Gene Alias
FEPS3; hNaN; HSAN7; Nan; NaT; NaV1.9; NSS2; Peripheral nerve sodium channel 5; PN5; Scn11a; SCN12A; sensory neuron sodium channel 2; SNS2; SNS-2; Sodium channel protein type 11 subunit alpha; sodium channel protein type XI subunit alpha; sodium channel voltage-gated type 11 alpha polypeptide; sodium channel voltage-gated type XI alpha polypeptide; sodium channel, voltage gated, type XI alpha subunit; sodium channel, voltage-gated, type 11, alpha polypeptide; sodium channel, voltage-gated, type XI, alpha; sodium channel, voltage-gated, type XI, alpha polypeptide; sodium channel, voltage-gated, type XI, alpha subunit; sodium channel, voltage-gated, type XII, alpha polypeptide; sodium channel, voltage-gated, type11, alpha polypeptide; sodium voltage-gated channel alpha subunit 11; voltage-gated sodium channel NAV1.9b; voltage-gated sodium channel subunit alpha Nav1.9
Host Species
Rabbit
Purification Method
Affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
11280, 24046, 29701
Content And Storage
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form
Lyophilized
Applications
Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
Concentration
500 μg/mL
Formulation
PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.
O88457, Q9R053, Q9UI33
Gene Symbols
SCN11A
Immunogen
A synthetic peptide corresponding to a sequence of human SCN11A (MDDRCYPVIFPDERNFRPFTSDSLAAIEKRIAIQKEKKK).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- Epithelial sodium channels are amiloride-sensitive members of the Degenerin/epithelial sodium channel (Deg/ENaC) superfamily of ion channels
- Members of this superfamily of ion channels share organizational similarity in that they all possess two short intracellular amino and carboxyl termini, two short membrane spanning segments, and a large extracellular loop with a conserved cysteine-rich region
- There are three homologous isoforms of the ENaC (alpha, beta, and gamma) protein
- ENaC in the kidney, lung, and colon plays an essential role in trans-epithelial sodium and fluid balance
- ENaC also mediates aldosterone-dependent sodium reabsorption in the distal nephron of the kidney, thus regulating blood pressure
- ENaC is thought to be regulated, in part, through association with the cystic fibrosis transmembrane conductance regulator (CFTR) chloride ion channel
- Gain-of-function mutations in beta- or gamma-ENaC can cause severe arterial hypertension (Liddels syndrome) and loss-of-function mutations in alpha- or beta-ENaC causes pseudohypoaldosteronism (PHA-1).
Compare Similar Items
Show Difference
Antigen: SCN11A
Classification: Polyclonal
Conjugate: Unconjugated
Gene: SCN11A
Gene Alias: FEPS3; hNaN; HSAN7; Nan; NaT; NaV1.9; NSS2; Peripheral nerve sodium channel 5; PN5; Scn11a; SCN12A; sensory neuron sodium channel 2; SNS2; SNS-2; Sodium channel protein type 11 subunit alpha; sodium channel protein type XI subunit alpha; sodium channel voltage-gated type 11 alpha polypeptide; sodium channel voltage-gated type XI alpha polypeptide; sodium channel, voltage gated, type XI alpha subunit; sodium channel, voltage-gated, type 11, alpha polypeptide; sodium channel, voltage-gated, type XI, alpha; sodium channel, voltage-gated, type XI, alpha polypeptide; sodium channel, voltage-gated, type XI, alpha subunit; sodium channel, voltage-gated, type XII, alpha polypeptide; sodium channel, voltage-gated, type11, alpha polypeptide; sodium voltage-gated channel alpha subunit 11; voltage-gated sodium channel NAV1.9b; voltage-gated sodium channel subunit alpha Nav1.9
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 11280, 24046, 29701
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form: Lyophilized
Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: O88457, Q9R053, Q9UI33
Gene Symbols: SCN11A
Immunogen: A synthetic peptide corresponding to a sequence of human SCN11A (MDDRCYPVIFPDERNFRPFTSDSLAAIEKRIAIQKEKKK).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: MT-ND4
Classification: Polyclonal
Conjugate: Unconjugated
Gene: MT-ND4
Gene Alias: mitochondrially encoded NADH dehydrogenase 4; Mtnd4; MT-ND4; NADH dehydrogenase subunit 4; NADH4; NADH-ubiquinone oxidoreductase chain 4; ND4
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 4538
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form: Lyophilized
Applications: ELISA, Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: P03905
Gene Symbols: MT-ND4
Immunogen: E.coli-derived human MT-ND4 recombinant protein (Position: M10-S459).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Product Type: Antibody
Isotype: IgG
Antigen: GATA4
Classification: Polyclonal
Conjugate: Unconjugated
Gene: GATA4
Gene Alias: ASD2; DNA-binding protein GATA-GT2; GAT4; GATA binding protein 4; GATA4; Gata-4; GATA-binding factor 4; GATA-binding protein 4; MGC126629; TACHD; TOF; Transcription factor GATA-4; VSD1
Host Species: Rabbit
Purification Method: Ammonium sulfate precipitation, Size-exclusion - Dialysis
Regulatory Status: RUO
Gene ID (Entrez): 2626
Content And Storage: -20° C, Avoid Freeze/Thaw Cycles
Form: Liquid
Applications: Flow Cytometry, Western Blot
Concentration: 2.0 mg/mL
Formulation: PBS with 0.09% sodium azide
Gene Accession No.: P43694
Gene Symbols: GATA4
Immunogen: KLH conjugated synthetic peptide between 298-328 amino acids from the C-terminal region of human GATA4
Quantity: 400 μL
Primary or Secondary: Primary
Target Species: Human
Product Type: Antibody
Isotype: IgG
