LRTOMT Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA5114402-Each-of-1 | In Stock | ₹ 44,705.10 |
PIPA5114402 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 44,705.10
GST (18%): ₹ 8,046.918
Total Price: ₹ 52,752.018
Antigen
LRTOMT
Classification
Polyclonal
Conjugate
Unconjugated
Gene
LRTOMT
Gene Alias
1700008D07Rik; Catechol O-methyltransferase 2; catechol O-methyltransferase 2 {ECO:0000250; CFAP111; Comt2; DFNB63; leucine rich repeat containing 51; leucine rich transmembrane and 0-methyltransferase domain containing; leucine rich transmembrane and O-methyltransferase domain containing; leucine-rich repeat-containing protein 51; leucine-rich repeat-containing protein 51 {ECO:0000312; leucine-rich repeat-containing protein 51; transmembrane O-methyltransferase; LRRC51; lrrc51 {ECO:0000312; Lrtomt; Lrtomt1; O-methyltransferase domain containing; PP7517; Protein LRTOMT1; protein LRTOMT2; RGD:1561509}; RGD:1565856}; RGD1561509; RGD1565856; Tomt; tomt {ECO:0000312; Transmembrane O-methyltransferase; transmembrane O-methyltransferase {ECO:0000312; Transmembrane O-methyltransferase homolog; UniProtKB:A1Y9I9}
Host Species
Rabbit
Purification Method
Affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
220074, 293156, 308868, 69358
Content And Storage
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form
Lyophilized
Applications
Immunohistochemistry (Paraffin), Western Blot
Concentration
500 μg/mL
Formulation
PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.
B6CZ61, B6CZ62, Q8WZ04, Q9DAK8
Gene Symbols
Lrrc51, LRTOMT
Immunogen
A synthetic peptide corresponding to a sequence of human LRTOMT (RLLTVERDPRTAAVAEKLIRLAGFDEHMVEL).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones
- Required for auditory function.
Compare Similar Items
Show Difference
Antigen: LRTOMT
Classification: Polyclonal
Conjugate: Unconjugated
Gene: LRTOMT
Gene Alias: 1700008D07Rik; Catechol O-methyltransferase 2; catechol O-methyltransferase 2 {ECO:0000250; CFAP111; Comt2; DFNB63; leucine rich repeat containing 51; leucine rich transmembrane and 0-methyltransferase domain containing; leucine rich transmembrane and O-methyltransferase domain containing; leucine-rich repeat-containing protein 51; leucine-rich repeat-containing protein 51 {ECO:0000312; leucine-rich repeat-containing protein 51; transmembrane O-methyltransferase; LRRC51; lrrc51 {ECO:0000312; Lrtomt; Lrtomt1; O-methyltransferase domain containing; PP7517; Protein LRTOMT1; protein LRTOMT2; RGD:1561509}; RGD:1565856}; RGD1561509; RGD1565856; Tomt; tomt {ECO:0000312; Transmembrane O-methyltransferase; transmembrane O-methyltransferase {ECO:0000312; Transmembrane O-methyltransferase homolog; UniProtKB:A1Y9I9}
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 220074, 293156, 308868, 69358
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form: Lyophilized
Applications: Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: B6CZ61, B6CZ62, Q8WZ04, Q9DAK8
Gene Symbols: Lrrc51, LRTOMT
Immunogen: A synthetic peptide corresponding to a sequence of human LRTOMT (RLLTVERDPRTAAVAEKLIRLAGFDEHMVEL).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: CCDC36
Classification: Polyclonal
Conjugate: Unconjugated
Gene: CCDC36
Gene Alias: Cancer/testis antigen 74; Ccdc36; coiled-coil domain containing 36; coiled-coil domain-containing protein 36; CT74; IHO1; Interactor of HORMAD1 protein 1
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 339834
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form: Lyophilized
Applications: ELISA, Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: Q8IYA8
Gene Symbols: CCDC36
Immunogen: E.coli-derived human CCDC36 recombinant protein (Position: E172-N472).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Product Type: Antibody
Isotype: IgG
Antigen: PYROXD1
Classification: Polyclonal
Conjugate: Unconjugated
Gene: PYROXD1
Gene Alias: FLJ22028; pyridine nucleotide-disulfide oxidoreductase domain-containing protein 1; pyridine nucleotide-disulphide oxidoreductase domain 1; PYROXD1
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 232491, 297708, 79912
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form: Lyophilized
Applications: ELISA, Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: Q3TMV7, Q68FS6, Q8WU10
Gene Symbols: PYROXD1
Immunogen: E.coli-derived human PYROXD1 recombinant protein (Position: K48-N230).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
