PIPA578712
ATP Citrate Lyase Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA578712-Each-of-1 | In Stock | ₹ 41,796.06 |
PIPA578712 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 41,796.06
GST (18%): ₹ 7,523.291
Total Price: ₹ 49,319.351
Antigen
ATP Citrate Lyase
Classification
Polyclonal
Conjugate
Unconjugated
Gene
Acly
Gene Alias
17-beta-HSD 10; 17-beta-hydroxysteroid dehydrogenase 10; 17bHSD10; 17b-HSD10; 2-methyl-3-hydroxybutyryl-CoA dehydrogenase; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; 3-hydroxyacyl-CoA dehydrogenase type-2; A730098H14Rik; ABAD; AB-binding alcohol dehydrogenase; ACL; ACLY; Ads9; amyloid beta-peptide binding protein; amyloid-beta peptide binding alcohol dehydrogenase; ATP citrate lyase; ATP-citrate (pro-S-)-lyase; ATP-citrate synthase; ATPCL; AW538652; CAMR; citrate cleavage enzyme; CLATP; DUPXp11.22; endoplasmic reticulum-associated amyloid beta-peptide-binding protein; ERAB; HADH2; HCD2; Hsd17b10; hydroxyacyl-Coenzyme A dehydrogenase type II; hydroxyacyl-Coenzyme A dehydrogenase, type II; hydroxysteroid (17-beta) dehydrogenase 10; hydroxysteroid 17-beta dehydrogenase 10; hydroxysteroid dehydrogenase 10; MHBD; Mitochondrial ribonuclease P protein 2; mitochondrial RNase P protein 2; mitochondrial RNase P subunit 2; MRPP2; MRX17; MRX31; MRXS10; SC
Host Species
Rabbit
Purification Method
Antigen affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
104112, 24159, 47
Content And Storage
-20°C
Form
Lyophilized
Applications
Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration
500 μg/mL
Formulation
PBS with 4MG trehalose and no preservative
Gene Accession No.
P16638, P53396, Q91V92
Gene Symbols
Acly
Immunogen
E. coli-derived human ATP citrate lyase recombinant protein (Position: M1-I180).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- ATP citrate lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues
- The enzyme is a tetramer (relative molecular weight approximately 440,000) of apparently identical subunits
- It catalyzes the formation of acetyl-CoA and oxaloacetate from citrate and CoA with a concomitant hydrolysis of ATP to ADP and phosphate
- The product, acetyl-CoA, serves several important biosynthetic pathways, including lipogenesis and cholesterogenesis
- In nervous tissue, ATP citrate-lyase may be involved in the biosynthesis of acetylcholine
- Two transcript variants encoding distinct isoforms have been identified for this gene.
Compare Similar Items
Show Difference
Antigen: ATP Citrate Lyase
Classification: Polyclonal
Conjugate: Unconjugated
Gene: Acly
Gene Alias: 17-beta-HSD 10; 17-beta-hydroxysteroid dehydrogenase 10; 17bHSD10; 17b-HSD10; 2-methyl-3-hydroxybutyryl-CoA dehydrogenase; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; 3-hydroxyacyl-CoA dehydrogenase type-2; A730098H14Rik; ABAD; AB-binding alcohol dehydrogenase; ACL; ACLY; Ads9; amyloid beta-peptide binding protein; amyloid-beta peptide binding alcohol dehydrogenase; ATP citrate lyase; ATP-citrate (pro-S-)-lyase; ATP-citrate synthase; ATPCL; AW538652; CAMR; citrate cleavage enzyme; CLATP; DUPXp11.22; endoplasmic reticulum-associated amyloid beta-peptide-binding protein; ERAB; HADH2; HCD2; Hsd17b10; hydroxyacyl-Coenzyme A dehydrogenase type II; hydroxyacyl-Coenzyme A dehydrogenase, type II; hydroxysteroid (17-beta) dehydrogenase 10; hydroxysteroid 17-beta dehydrogenase 10; hydroxysteroid dehydrogenase 10; MHBD; Mitochondrial ribonuclease P protein 2; mitochondrial RNase P protein 2; mitochondrial RNase P subunit 2; MRPP2; MRX17; MRX31; MRXS10; SC
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 104112, 24159, 47
Content And Storage: -20°C
Form: Lyophilized
Applications: Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and no preservative
Gene Accession No.: P16638, P53396, Q91V92
Gene Symbols: Acly
Immunogen: E. coli-derived human ATP citrate lyase recombinant protein (Position: M1-I180).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen:
ATP Citrate Lyase
Classification:
Polyclonal
Conjugate:
Unconjugated
Gene:
Acly
Gene Alias:
17-beta-HSD 10; 17-beta-hydroxysteroid dehydrogenase 10; 17bHSD10; 17b-HSD10; 2-methyl-3-hydroxybutyryl-CoA dehydrogenase; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; 3-hydroxyacyl-CoA dehydrogenase type-2; A730098H14Rik; ABAD; AB-binding alcohol dehydrogenase; ACL; ACLY; Ads9; amyloid beta-peptide binding protein; amyloid-beta peptide binding alcohol dehydrogenase; ATP citrate lyase; ATP-citrate (pro-S-)-lyase; ATP-citrate synthase; ATPCL; AW538652; CAMR; citrate cleavage enzyme; CLATP; DUPXp11.22; endoplasmic reticulum-associated amyloid beta-peptide-binding protein; ERAB; HADH2; HCD2; Hsd17b10; hydroxyacyl-Coenzyme A dehydrogenase type II; hydroxyacyl-Coenzyme A dehydrogenase, type II; hydroxysteroid (17-beta) dehydrogenase 10; hydroxysteroid 17-beta dehydrogenase 10; hydroxysteroid dehydrogenase 10; MHBD; Mitochondrial ribonuclease P protein 2; mitochondrial RNase P protein 2; mitochondrial RNase P subunit 2; MRPP2; MRX17; MRX31; MRXS10; SC
Host Species:
Rabbit
Purification Method:
Antigen affinity chromatography
Regulatory Status:
RUO
Gene ID (Entrez):
104112, 24159, 47
Content And Storage:
-20°C
Form:
Lyophilized
Applications:
Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration:
500 μg/mL
Formulation:
PBS with 4MG trehalose and no preservative
Gene Accession No.:
P16638, P53396, Q91V92
Gene Symbols:
Acly
Immunogen:
E. coli-derived human ATP citrate lyase recombinant protein (Position: M1-I180).
Quantity:
100 μg
Primary or Secondary:
Primary
Target Species:
Human, Mouse, Rat
Product Type:
Antibody
Isotype:
IgG
Antigen: ACSL1
Classification: Polyclonal
Conjugate: Unconjugated
Gene: ACSL1
Gene Alias: Acas; Acas1; ACS; Acs1; ACSL1; Acsl2; Acyl CoA synthetase, long chain; acyl-CoA synthetase 1; acyl-CoA synthetase long chain family member 1; acyl-CoA synthetase long-chain family member 1; Arachidonate--CoA ligase; COAA; FACL1; Facl2; FACS; fatty acid Coenzyme A ligase, long chain 2; fatty-acid-Coenzyme A ligase long chain 2; fatty-acid-Coenzyme A ligase, long-chain 1; fatty-acid-Coenzyme A ligase, long-chain 2; L LACS2; LACS; LACS 1; LACS 2; LACS1; LACS2; lignoceroyl-CoA synthase; long-chain acyl-CoA synthetase 1; Long-chain acyl-CoA synthetase 2; long-chain fatty acid-CoA ligase 2; long-chain fatty-acid-coenzyme A ligase 1; long-chain-fatty-acid--CoA ligase 1; Long-chain-fatty-acid--CoA ligase, liver isozyme; OTTHUMP00000218457; OTTHUMP00000218460; OTTHUMP00000218462; OTTHUMP00000218465; palmitoyl-CoA ligase; Palmitoyl-CoA ligase 1; palmitoyl-CoA ligase 2; paltimoyl-CoA ligase 1; Phytanate--CoA ligase
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 14081, 2180, 25288
Content And Storage: -20°C
Form: Lyophilized
Applications: Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: P18163, P33121, P41216
Gene Symbols: ACSL1
Immunogen: E. coli-derived human ACSL1 recombinant protein (Position: D604-V698).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen:
ACSL1
Classification:
Polyclonal
Conjugate:
Unconjugated
Gene:
ACSL1
Gene Alias:
Acas; Acas1; ACS; Acs1; ACSL1; Acsl2; Acyl CoA synthetase, long chain; acyl-CoA synthetase 1; acyl-CoA synthetase long chain family member 1; acyl-CoA synthetase long-chain family member 1; Arachidonate--CoA ligase; COAA; FACL1; Facl2; FACS; fatty acid Coenzyme A ligase, long chain 2; fatty-acid-Coenzyme A ligase long chain 2; fatty-acid-Coenzyme A ligase, long-chain 1; fatty-acid-Coenzyme A ligase, long-chain 2; L LACS2; LACS; LACS 1; LACS 2; LACS1; LACS2; lignoceroyl-CoA synthase; long-chain acyl-CoA synthetase 1; Long-chain acyl-CoA synthetase 2; long-chain fatty acid-CoA ligase 2; long-chain fatty-acid-coenzyme A ligase 1; long-chain-fatty-acid--CoA ligase 1; Long-chain-fatty-acid--CoA ligase, liver isozyme; OTTHUMP00000218457; OTTHUMP00000218460; OTTHUMP00000218462; OTTHUMP00000218465; palmitoyl-CoA ligase; Palmitoyl-CoA ligase 1; palmitoyl-CoA ligase 2; paltimoyl-CoA ligase 1; Phytanate--CoA ligase
Host Species:
Rabbit
Purification Method:
Antigen affinity chromatography
Regulatory Status:
RUO
Gene ID (Entrez):
14081, 2180, 25288
Content And Storage:
-20°C
Form:
Lyophilized
Applications:
Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration:
500 μg/mL
Formulation:
PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.:
P18163, P33121, P41216
Gene Symbols:
ACSL1
Immunogen:
E. coli-derived human ACSL1 recombinant protein (Position: D604-V698).
Quantity:
100 μg
Primary or Secondary:
Primary
Target Species:
Human, Mouse, Rat
Product Type:
Antibody
Isotype:
IgG
Antigen: ACSL5
Classification: Polyclonal
Conjugate: Unconjugated
Gene: ACSL5
Gene Alias: 1700030F05Rik; ACS2; ACS5; Acsl5; acyl-CoA synthetase 5; acyl-CoA synthetase long chain family member 5; acyl-CoA synthetase long-chain family member 5; Arachidonate--CoA ligase; FACL5; FACL5 for fatty acid coenzyme A ligase 5; fatty acid coenzyme A ligase 5; fatty acid Coenzyme A ligase, long chain 5; fatty-acid-Coenzyme A ligase, long-chain 5; HGNC:16526; LACS 5; Long-chain acyl-CoA synthetase 5; long-chain fatty acid coenzyme A ligase 5; long-chain-fatty-acid--CoA ligase 5; UNQ633/PRO1250; zgc:92083
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 433256, 51703, 94340
Content And Storage: -20°C
Form: Lyophilized
Applications: Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: O88813, Q8JZR0, Q9ULC5
Gene Symbols: ACSL5
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ACSL5 (337-378aa ADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLLKLA).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen:
ACSL5
Classification:
Polyclonal
Conjugate:
Unconjugated
Gene:
ACSL5
Gene Alias:
1700030F05Rik; ACS2; ACS5; Acsl5; acyl-CoA synthetase 5; acyl-CoA synthetase long chain family member 5; acyl-CoA synthetase long-chain family member 5; Arachidonate--CoA ligase; FACL5; FACL5 for fatty acid coenzyme A ligase 5; fatty acid coenzyme A ligase 5; fatty acid Coenzyme A ligase, long chain 5; fatty-acid-Coenzyme A ligase, long-chain 5; HGNC:16526; LACS 5; Long-chain acyl-CoA synthetase 5; long-chain fatty acid coenzyme A ligase 5; long-chain-fatty-acid--CoA ligase 5; UNQ633/PRO1250; zgc:92083
Host Species:
Rabbit
Purification Method:
Antigen affinity chromatography
Regulatory Status:
RUO
Gene ID (Entrez):
433256, 51703, 94340
Content And Storage:
-20°C
Form:
Lyophilized
Applications:
Western Blot
Concentration:
500 μg/mL
Formulation:
PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.:
O88813, Q8JZR0, Q9ULC5
Gene Symbols:
ACSL5
Immunogen:
A synthetic peptide corresponding to a sequence in the middle region of human ACSL5 (337-378aa ADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLLKLA).
Quantity:
100 μg
Primary or Secondary:
Primary
Target Species:
Human, Mouse, Rat
Product Type:
Antibody
Isotype:
IgG
Antigen: Actin
Classification: Polyclonal
Conjugate: Unconjugated
Gene: ACTA2
Gene Alias: 0610041G09Rik; 5C actin; A; A4V404_DROME; AA959943; a-actin; AAT6; Ac5C; act; act 5C; ACT1_DROME; Act4; ACT-4; Act5; ACT-5; Act5c; Act-5C; Act5C-PA; Act5C-PB; Act5C-PC; Act5C-PD; Act5C-PE; acta; ACTA1; ACTA1 protein; acta1.S; acta2; Acta-2; ACTA3; ACTB; actb.L; ACTC; ACTC1; Actc-1; ACTE; Actg; ACTG1; Actg2; ACTGE; Actin; actin 5 C; actin 5c; actin A1; actin alpha 1; actin alpha 1, skeletal muscle; actin alpha 2, smooth muscle; actin alpha cardiac; actin alpha cardiac 1; actin alpha cardiac muscle 1; actin beta; actin gamma 1; actin gamma 2, smooth muscle; actin homolog; actin, alpha 1, skeletal muscle; actin, alpha 1, skeletal muscle S homeolog; actin, alpha 2, smooth muscle, aorta; actin, alpha cardiac muscle 1; Actin, alpha cardiac muscle 1, intermediate form; Actin, alpha skeletal muscle; actin, alpha skeletal muscle S homeolog; Actin, alpha skeletal muscle, intermediate form; actin, alpha, cardiac 1; actin, alpha, cardiac muscle; actin, alpha, cardiac muscle 1; actin, alpha, vascular smooth muscle; Actin, aortic smooth muscle; Actin, aortic smooth muscle, intermediate form; actin, beta; actin, beta L homeolog; actin, beta, cytoplasmic; actin, cytoplasmic 1; Actin, cytoplasmic 1, N-terminally processed; Actin, cytoplasmic 2; Actin, cytoplasmic 2, N-terminally processed; Actin, cytoplasmic type 5; actin, cytoplasmic, type 5; actin, gamma 1; actin, gamma 1 propeptide; actin, gamma 2; actin, gamma 2, smooth muscle, enteric; actin, gamma, cytoplasmic 1; actin, gamma-enteric smooth muscle; Actin, gamma-enteric smooth muscle, intermediate form; Actin/BAP47; Actin5C; Actin-5C; actin-like protein; Actl; ACTL3; Acts; ACTSA; ACTSG; Actsk-1; Actvs; Actx; AL023024; alpha 1 skeletal muscle actin; alpha actin; alpha actin 1; alpha actin 2; alpha-actin; alpha-actin cardiac; alpha-actin-1; Alpha-actin-2; alpha-actin-3; alphac-actin; Alpha-cardiac actin; alphaSMA; alpha-sma; alpha-smooth muscle actin; anon-EST:fe2D2; anon-fast-evolving-2D2; ArpA; ASD5; asma; a-SMA; Atcb; Bact; Bact; actin; B-actin; Bap47; beta actin; beta cytoskeletal actin; beta-actin; beta-actin FE-3; beta-actin/Bap47; BRWS1; BRWS2; cardiac actin; cardiac muscle alpha actin 1; cell growth-inhibiting gene 46 protein; cellular cytoskeletal beta-actin; CFTD; CFTD1; CFTDM; CG4027; CG4027-PA; CG4027-PB; CG4027-PC; CG4027-PD; CG4027-PE; chrX:5748184..5748304; CMD1R; CMH11; cyt5C; cytoplasmic 1; cytoplasmic 2; cytoplasmic actin; cytoplasmic beta-actin; cytoplasmic type 5; cytoskeletal beta actin; cytoskeletal gamma-actin; cytoskeletal protein; deafness, autosomal dominant 20; deafness, autosomal dominant 26; DFNA20; DFNA26; Dm-actin5C; Dmel\CG4027; Dmel_CG4027; E430023M04Rik; E51; epididymis luminal protein 176; F-actin; G-actin; gamma 1 propeptide; gamma non-muscle actin; gamma-2-actin; Gamma-actin; gamma-enteric smooth muscle actin; GIG46; HEL-176; hypothetical protein LOC515610; I79_002310; I79_013242; I79_019066; l(1)G0009; l(1)G0010; l(1)G0025; l(1)G0079; l(1)G0117; l(1)G0177; l(1)G0245; l(1)G0330; l(1)G0420; l(1)G0486; LOW QUALITY PROTEIN: actin, alpha skeletal muscle; LOW QUALITY PROTEIN: actin, aortic smooth muscle; LVNC4; M32055; mpfd; MYMY5; NEM1; NEM2; NEM3; nemaline myopathy type 3; pan actin; PS1TP5-binding protein 1; PS1TP5BP1; RE02927p; RP5-1068B5.2; SHPM; similar to b-actin; similar to beta actin; skeletal alpha actin; sma; SMalphaA; SMGA; smooth muscle alpha-actin; smooth muscle gamma-actin; T11; type 5; unnamed protein product; vascular smooth muscle alpha-actin; VSCM; wu:fb63d03; XELAEV_18029136mg; XELAEV_18045052mg
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 11459, 11461, 11464, 11465, 11468, 11475, 25365, 287876, 29275, 29437, 58, 59, 60, 70, 71, 72, 81633, 81822
Content And Storage: -20°C
Form: Lyophilized
Applications: Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and no preservative
Gene Accession No.: P60709, P60710, P60711, P62736, P62737, P62738, P63259, P63260, P63261, P63267, P63268, P63269, P68032, P68033, P68035, P68133, P68134, P68136
Gene Symbols: Acta1, ACTA2, ACTB, ACTC1, ACTG1, ACTG2
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Actin (277-308aa HETTYNSIMKCDIDIRKDLYANNVMSGGTTMY).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen:
Actin
Classification:
Polyclonal
Conjugate:
Unconjugated
Gene:
ACTA2
Gene Alias:
0610041G09Rik; 5C actin; A; A4V404_DROME; AA959943; a-actin; AAT6; Ac5C; act; act 5C; ACT1_DROME; Act4; ACT-4; Act5; ACT-5; Act5c; Act-5C; Act5C-PA; Act5C-PB; Act5C-PC; Act5C-PD; Act5C-PE; acta; ACTA1; ACTA1 protein; acta1.S; acta2; Acta-2; ACTA3; ACTB; actb.L; ACTC; ACTC1; Actc-1; ACTE; Actg; ACTG1; Actg2; ACTGE; Actin; actin 5 C; actin 5c; actin A1; actin alpha 1; actin alpha 1, skeletal muscle; actin alpha 2, smooth muscle; actin alpha cardiac; actin alpha cardiac 1; actin alpha cardiac muscle 1; actin beta; actin gamma 1; actin gamma 2, smooth muscle; actin homolog; actin, alpha 1, skeletal muscle; actin, alpha 1, skeletal muscle S homeolog; actin, alpha 2, smooth muscle, aorta; actin, alpha cardiac muscle 1; Actin, alpha cardiac muscle 1, intermediate form; Actin, alpha skeletal muscle; actin, alpha skeletal muscle S homeolog; Actin, alpha skeletal muscle, intermediate form; actin, alpha, cardiac 1; actin, alpha, cardiac muscle; actin, alpha, cardiac muscle 1; actin, alpha, vascular smooth muscle; Actin, aortic smooth muscle; Actin, aortic smooth muscle, intermediate form; actin, beta; actin, beta L homeolog; actin, beta, cytoplasmic; actin, cytoplasmic 1; Actin, cytoplasmic 1, N-terminally processed; Actin, cytoplasmic 2; Actin, cytoplasmic 2, N-terminally processed; Actin, cytoplasmic type 5; actin, cytoplasmic, type 5; actin, gamma 1; actin, gamma 1 propeptide; actin, gamma 2; actin, gamma 2, smooth muscle, enteric; actin, gamma, cytoplasmic 1; actin, gamma-enteric smooth muscle; Actin, gamma-enteric smooth muscle, intermediate form; Actin/BAP47; Actin5C; Actin-5C; actin-like protein; Actl; ACTL3; Acts; ACTSA; ACTSG; Actsk-1; Actvs; Actx; AL023024; alpha 1 skeletal muscle actin; alpha actin; alpha actin 1; alpha actin 2; alpha-actin; alpha-actin cardiac; alpha-actin-1; Alpha-actin-2; alpha-actin-3; alphac-actin; Alpha-cardiac actin; alphaSMA; alpha-sma; alpha-smooth muscle actin; anon-EST:fe2D2; anon-fast-evolving-2D2; ArpA; ASD5; asma; a-SMA; Atcb; Bact; Bact; actin; B-actin; Bap47; beta actin; beta cytoskeletal actin; beta-actin; beta-actin FE-3; beta-actin/Bap47; BRWS1; BRWS2; cardiac actin; cardiac muscle alpha actin 1; cell growth-inhibiting gene 46 protein; cellular cytoskeletal beta-actin; CFTD; CFTD1; CFTDM; CG4027; CG4027-PA; CG4027-PB; CG4027-PC; CG4027-PD; CG4027-PE; chrX:5748184..5748304; CMD1R; CMH11; cyt5C; cytoplasmic 1; cytoplasmic 2; cytoplasmic actin; cytoplasmic beta-actin; cytoplasmic type 5; cytoskeletal beta actin; cytoskeletal gamma-actin; cytoskeletal protein; deafness, autosomal dominant 20; deafness, autosomal dominant 26; DFNA20; DFNA26; Dm-actin5C; Dmel\CG4027; Dmel_CG4027; E430023M04Rik; E51; epididymis luminal protein 176; F-actin; G-actin; gamma 1 propeptide; gamma non-muscle actin; gamma-2-actin; Gamma-actin; gamma-enteric smooth muscle actin; GIG46; HEL-176; hypothetical protein LOC515610; I79_002310; I79_013242; I79_019066; l(1)G0009; l(1)G0010; l(1)G0025; l(1)G0079; l(1)G0117; l(1)G0177; l(1)G0245; l(1)G0330; l(1)G0420; l(1)G0486; LOW QUALITY PROTEIN: actin, alpha skeletal muscle; LOW QUALITY PROTEIN: actin, aortic smooth muscle; LVNC4; M32055; mpfd; MYMY5; NEM1; NEM2; NEM3; nemaline myopathy type 3; pan actin; PS1TP5-binding protein 1; PS1TP5BP1; RE02927p; RP5-1068B5.2; SHPM; similar to b-actin; similar to beta actin; skeletal alpha actin; sma; SMalphaA; SMGA; smooth muscle alpha-actin; smooth muscle gamma-actin; T11; type 5; unnamed protein product; vascular smooth muscle alpha-actin; VSCM; wu:fb63d03; XELAEV_18029136mg; XELAEV_18045052mg
Host Species:
Rabbit
Purification Method:
Antigen affinity chromatography
Regulatory Status:
RUO
Gene ID (Entrez):
11459, 11461, 11464, 11465, 11468, 11475, 25365, 287876, 29275, 29437, 58, 59, 60, 70, 71, 72, 81633, 81822
Content And Storage:
-20°C
Form:
Lyophilized
Applications:
Immunohistochemistry (Paraffin), Western Blot
Concentration:
500 μg/mL
Formulation:
PBS with 4MG trehalose and no preservative
Gene Accession No.:
P60709, P60710, P60711, P62736, P62737, P62738, P63259, P63260, P63261, P63267, P63268, P63269, P68032, P68033, P68035, P68133, P68134, P68136
Gene Symbols:
Acta1, ACTA2, ACTB, ACTC1, ACTG1, ACTG2
Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human Actin (277-308aa HETTYNSIMKCDIDIRKDLYANNVMSGGTTMY).
Quantity:
100 μg
Primary or Secondary:
Primary
Target Species:
Human, Mouse, Rat
Product Type:
Antibody
Isotype:
IgG