Actin Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA578716-Each-of-1 | In Stock | ₹ 40,683.78 |
PIPA578716 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 40,683.78
GST (18%): ₹ 7,323.08
Total Price: ₹ 48,006.86
Antigen
Actin
Classification
Polyclonal
Conjugate
Unconjugated
Gene
ACTG1
Gene Alias
0610041G09Rik; 5C actin; A; A4V404_DROME; AA959943; a-actin; AAT6; Ac5C; act; act 5C; ACT1_DROME; Act4; ACT-4; Act5; ACT-5; Act5c; Act-5C; Act5C-PA; Act5C-PB; Act5C-PC; Act5C-PD; Act5C-PE; acta; ACTA1; ACTA1 protein; acta1.S; acta2; Acta-2; ACTA3; ACTB; actb.L; ACTC; ACTC1; Actc-1; ACTE; Actg; ACTG1; Actg2; ACTGE; Actin; actin 5 C; actin 5c; actin A1; actin alpha 1; actin alpha 1, skeletal muscle; actin alpha 2, smooth muscle; actin alpha cardiac; actin alpha cardiac 1; actin alpha cardiac muscle 1; actin beta; actin gamma 1; actin gamma 2, smooth muscle; actin homolog; actin, alpha 1, skeletal muscle; actin, alpha 1, skeletal muscle S homeolog; actin, alpha 2, smooth muscle, aorta; actin, alpha cardiac muscle 1; Actin, alpha cardiac muscle 1, intermediate form; Actin, alpha skeletal muscle; actin, alpha skeletal muscle S homeolog; Actin, alpha skeletal muscle, intermediate form; actin, alpha, cardiac 1; actin, alpha, cardiac muscle; actin, alpha, cardiac muscle 1; actin, alpha, vascular smooth muscle; Actin, aortic smooth muscle; Actin, aortic smooth muscle, intermediate form; actin, beta; actin, beta L homeolog; actin, beta, cytoplasmic; actin, cytoplasmic 1; Actin, cytoplasmic 1, N-terminally processed; Actin, cytoplasmic 2; Actin, cytoplasmic 2, N-terminally processed; Actin, cytoplasmic type 5; actin, cytoplasmic, type 5; actin, gamma 1; actin, gamma 1 propeptide; actin, gamma 2; actin, gamma 2, smooth muscle, enteric; actin, gamma, cytoplasmic 1; actin, gamma-enteric smooth muscle; Actin, gamma-enteric smooth muscle, intermediate form; Actin/BAP47; Actin5C; Actin-5C; actin-like protein; Actl; ACTL3; Acts; ACTSA; ACTSG; Actsk-1; Actvs; Actx; AL023024; alpha 1 skeletal muscle actin; alpha actin; alpha actin 1; alpha actin 2; alpha-actin; alpha-actin cardiac; alpha-actin-1; Alpha-actin-2; alpha-actin-3; alphac-actin; Alpha-cardiac actin; alphaSMA; alpha-sma; alpha-smooth muscle actin; anon-EST:fe2D2; anon-fast-evolving-2D2; ArpA; ASD5; asma; a-SMA; Atcb; Bact; Bact; actin; B-actin; Bap47; beta actin; beta cytoskeletal actin; beta-actin; beta-actin FE-3; beta-actin/Bap47; BRWS1; BRWS2; cardiac actin; cardiac muscle alpha actin 1; cell growth-inhibiting gene 46 protein; cellular cytoskeletal beta-actin; CFTD; CFTD1; CFTDM; CG4027; CG4027-PA; CG4027-PB; CG4027-PC; CG4027-PD; CG4027-PE; chrX:5748184..5748304; CMD1R; CMH11; cyt5C; cytoplasmic 1; cytoplasmic 2; cytoplasmic actin; cytoplasmic beta-actin; cytoplasmic type 5; cytoskeletal beta actin; cytoskeletal gamma-actin; cytoskeletal protein; deafness, autosomal dominant 20; deafness, autosomal dominant 26; DFNA20; DFNA26; Dm-actin5C; Dmel\CG4027; Dmel_CG4027; E430023M04Rik; E51; epididymis luminal protein 176; F-actin; G-actin; gamma 1 propeptide; gamma non-muscle actin; gamma-2-actin; Gamma-actin; gamma-enteric smooth muscle actin; GIG46; HEL-176; hypothetical protein LOC515610; I79_002310; I79_013242; I79_019066; l(1)G0009; l(1)G0010; l(1)G0025; l(1)G0079; l(1)G0117; l(1)G0177; l(1)G0245; l(1)G0330; l(1)G0420; l(1)G0486; LOW QUALITY PROTEIN: actin, alpha skeletal muscle; LOW QUALITY PROTEIN: actin, aortic smooth muscle; LVNC4; M32055; mpfd; MYMY5; NEM1; NEM2; NEM3; nemaline myopathy type 3; pan actin; PS1TP5-binding protein 1; PS1TP5BP1; RE02927p; RP5-1068B5.2; SHPM; similar to b-actin; similar to beta actin; skeletal alpha actin; sma; SMalphaA; SMGA; smooth muscle alpha-actin; smooth muscle gamma-actin; T11; type 5; unnamed protein product; vascular smooth muscle alpha-actin; VSCM; wu:fb63d03; XELAEV_18029136mg; XELAEV_18045052mg
Host Species
Rabbit
Purification Method
Antigen affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
11459, 11461, 11464, 11465, 11468, 11475, 25365, 287876, 29275, 29437, 58, 59, 60, 70, 71, 72, 81633, 81822
Content And Storage
-20°C
Form
Lyophilized
Applications
Immunohistochemistry (Paraffin), Western Blot
Concentration
500 μg/mL
Formulation
PBS with 4MG trehalose and no preservative
Gene Accession No.
P60709, P60710, P60711, P62736, P62737, P62738, P63259, P63260, P63261, P63267, P63268, P63269, P68032, P68033, P68035, P68133, P68134, P68136
Gene Symbols
Acta1, ACTA2, ACTB, ACTC1, ACTG1, ACTG2
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Actin (359-377aa ITKQEYDEAGPSIVHRKCF).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- Actin exists as a ubiquitous protein involved with filament formation that make up large portions of the cytoskeleton
- Actin filaments interact with myosin to assist in muscle contraction as well as aiding in cell motility and cytokinesis
- In vertebrates there are three groups of actin isoforms: alpha, beta and gamma
- The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus
- The beta and gamma actins co-exists in most cell types as components of the cytoskeleton and as mediators of internal cell motility.
Compare Similar Items
Show Difference
Antigen: Actin
Classification: Polyclonal
Conjugate: Unconjugated
Gene: ACTG1
Gene Alias: 0610041G09Rik; 5C actin; A; A4V404_DROME; AA959943; a-actin; AAT6; Ac5C; act; act 5C; ACT1_DROME; Act4; ACT-4; Act5; ACT-5; Act5c; Act-5C; Act5C-PA; Act5C-PB; Act5C-PC; Act5C-PD; Act5C-PE; acta; ACTA1; ACTA1 protein; acta1.S; acta2; Acta-2; ACTA3; ACTB; actb.L; ACTC; ACTC1; Actc-1; ACTE; Actg; ACTG1; Actg2; ACTGE; Actin; actin 5 C; actin 5c; actin A1; actin alpha 1; actin alpha 1, skeletal muscle; actin alpha 2, smooth muscle; actin alpha cardiac; actin alpha cardiac 1; actin alpha cardiac muscle 1; actin beta; actin gamma 1; actin gamma 2, smooth muscle; actin homolog; actin, alpha 1, skeletal muscle; actin, alpha 1, skeletal muscle S homeolog; actin, alpha 2, smooth muscle, aorta; actin, alpha cardiac muscle 1; Actin, alpha cardiac muscle 1, intermediate form; Actin, alpha skeletal muscle; actin, alpha skeletal muscle S homeolog; Actin, alpha skeletal muscle, intermediate form; actin, alpha, cardiac 1; actin, alpha, cardiac muscle; actin, alpha, cardiac muscle 1; actin, alpha, vascular smooth muscle; Actin, aortic smooth muscle; Actin, aortic smooth muscle, intermediate form; actin, beta; actin, beta L homeolog; actin, beta, cytoplasmic; actin, cytoplasmic 1; Actin, cytoplasmic 1, N-terminally processed; Actin, cytoplasmic 2; Actin, cytoplasmic 2, N-terminally processed; Actin, cytoplasmic type 5; actin, cytoplasmic, type 5; actin, gamma 1; actin, gamma 1 propeptide; actin, gamma 2; actin, gamma 2, smooth muscle, enteric; actin, gamma, cytoplasmic 1; actin, gamma-enteric smooth muscle; Actin, gamma-enteric smooth muscle, intermediate form; Actin/BAP47; Actin5C; Actin-5C; actin-like protein; Actl; ACTL3; Acts; ACTSA; ACTSG; Actsk-1; Actvs; Actx; AL023024; alpha 1 skeletal muscle actin; alpha actin; alpha actin 1; alpha actin 2; alpha-actin; alpha-actin cardiac; alpha-actin-1; Alpha-actin-2; alpha-actin-3; alphac-actin; Alpha-cardiac actin; alphaSMA; alpha-sma; alpha-smooth muscle actin; anon-EST:fe2D2; anon-fast-evolving-2D2; ArpA; ASD5; asma; a-SMA; Atcb; Bact; Bact; actin; B-actin; Bap47; beta actin; beta cytoskeletal actin; beta-actin; beta-actin FE-3; beta-actin/Bap47; BRWS1; BRWS2; cardiac actin; cardiac muscle alpha actin 1; cell growth-inhibiting gene 46 protein; cellular cytoskeletal beta-actin; CFTD; CFTD1; CFTDM; CG4027; CG4027-PA; CG4027-PB; CG4027-PC; CG4027-PD; CG4027-PE; chrX:5748184..5748304; CMD1R; CMH11; cyt5C; cytoplasmic 1; cytoplasmic 2; cytoplasmic actin; cytoplasmic beta-actin; cytoplasmic type 5; cytoskeletal beta actin; cytoskeletal gamma-actin; cytoskeletal protein; deafness, autosomal dominant 20; deafness, autosomal dominant 26; DFNA20; DFNA26; Dm-actin5C; Dmel\CG4027; Dmel_CG4027; E430023M04Rik; E51; epididymis luminal protein 176; F-actin; G-actin; gamma 1 propeptide; gamma non-muscle actin; gamma-2-actin; Gamma-actin; gamma-enteric smooth muscle actin; GIG46; HEL-176; hypothetical protein LOC515610; I79_002310; I79_013242; I79_019066; l(1)G0009; l(1)G0010; l(1)G0025; l(1)G0079; l(1)G0117; l(1)G0177; l(1)G0245; l(1)G0330; l(1)G0420; l(1)G0486; LOW QUALITY PROTEIN: actin, alpha skeletal muscle; LOW QUALITY PROTEIN: actin, aortic smooth muscle; LVNC4; M32055; mpfd; MYMY5; NEM1; NEM2; NEM3; nemaline myopathy type 3; pan actin; PS1TP5-binding protein 1; PS1TP5BP1; RE02927p; RP5-1068B5.2; SHPM; similar to b-actin; similar to beta actin; skeletal alpha actin; sma; SMalphaA; SMGA; smooth muscle alpha-actin; smooth muscle gamma-actin; T11; type 5; unnamed protein product; vascular smooth muscle alpha-actin; VSCM; wu:fb63d03; XELAEV_18029136mg; XELAEV_18045052mg
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 11459, 11461, 11464, 11465, 11468, 11475, 25365, 287876, 29275, 29437, 58, 59, 60, 70, 71, 72, 81633, 81822
Content And Storage: -20°C
Form: Lyophilized
Applications: Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and no preservative
Gene Accession No.: P60709, P60710, P60711, P62736, P62737, P62738, P63259, P63260, P63261, P63267, P63268, P63269, P68032, P68033, P68035, P68133, P68134, P68136
Gene Symbols: Acta1, ACTA2, ACTB, ACTC1, ACTG1, ACTG2
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Actin (359-377aa ITKQEYDEAGPSIVHRKCF).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: alpha Actinin 3
Classification: Polyclonal
Conjugate: DyLight 488
Gene: Actn3
Gene Alias: actinin alpha 3; actinin alpha 3 (gene/pseudogene); Actinin alpha3; actinin, alpha 3; Actinin-alpha3; ACTN3; alpha-actinin skeletal muscle; Alpha-actinin skeletal muscle isoform 3; alpha-Actinin3; Alpha-actinin-3; alphaActinin-3; F-actin cross-linking protein
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 89
Content And Storage: -20° C, Avoid Freeze/Thaw Cycles, store in dark
Form: Liquid
Applications: Flow Cytometry
Concentration: 0.5 mg/mL
Formulation: PBS with 50% glycerol and 0.02% sodium azide
Gene Accession No.: Q08043
Gene Symbols: Actn3
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Product Type: Antibody
Isotype: IgG
Antigen: Adenosine Deaminase
Classification: Polyclonal
Conjugate: Unconjugated
Gene: ADA
Gene Alias: ada; ADA1; adenosine aminohydrolase; Adenosine deaminase; RP11-61L14.5; zgc:92028
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 11486, 24165
Content And Storage: -20°C
Form: Lyophilized
Applications: Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: P03958, Q920P6
Gene Symbols: ADA
Immunogen: E. coli-derived mouse ADA recombinant protein (Position: A2-H238).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Mouse, Rat
Product Type: Antibody
Isotype: IgG
