RAGE Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA578735-Each-of-1 | In Stock | ₹ 42,223.86 |
PIPA578735 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 42,223.86
GST (18%): ₹ 7,600.295
Total Price: ₹ 49,824.155
Antigen
RAGE
Classification
Polyclonal
Conjugate
Unconjugated
Gene
AGER
Gene Alias
advanced glycation end product receptor; advanced glycation end-product receptor; advanced glycation end-products receptor; advanced glycosylation end product-specific receptor; advanced glycosylation end product-specific receptor variant 2; advanced glycosylation end product-specific receptor variant 3; advanced glycosylation end product-specific receptor variant 4; advanced glycosylation end product-specific receptor variant 5; advanced glycosylation end-product specific receptor; Ager; MAPK/MAK/MRK overlapping kinase; MOK; MOK protein kinase; RAGE; RAGE isoform NtRAGE-delta; RAGE isoform sRAGE-delta; RAGE/AGER; RAGE1; RAGE-1; RAGE-4 ORF3; receptor for advanced glycation endproducts; receptor for advanced glycation end-products variant 20; receptor for advanced glycosylation end products; receptor of advanced glycosylation end products of proteins; immunoglobulin superfamily; MHC class II; MHC class III; renal cell carcinoma antigen; renal tumor antigen 1; SCARJ1; sRAGE; STK30
Host Species
Rabbit
Purification Method
Antigen affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
11596, 177, 81722
Content And Storage
-20°C
Form
Lyophilized
Applications
Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot
Concentration
500 μg/mL
Formulation
PBS with 5MG BSA and 0.05MG sodium azide, 0.05MG thimerosal
Gene Accession No.
Q15109, Q62151, Q63495
Gene Symbols
AGER
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human RAGE (174-192aa KEQTRRHPETGLFTLQSEL).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- Able to phosphorylate several exogenous substrates and to undergo autophosphorylation.
Compare Similar Items
Show Difference
Antigen: RAGE
Classification: Polyclonal
Conjugate: Unconjugated
Gene: AGER
Gene Alias: advanced glycation end product receptor; advanced glycation end-product receptor; advanced glycation end-products receptor; advanced glycosylation end product-specific receptor; advanced glycosylation end product-specific receptor variant 2; advanced glycosylation end product-specific receptor variant 3; advanced glycosylation end product-specific receptor variant 4; advanced glycosylation end product-specific receptor variant 5; advanced glycosylation end-product specific receptor; Ager; MAPK/MAK/MRK overlapping kinase; MOK; MOK protein kinase; RAGE; RAGE isoform NtRAGE-delta; RAGE isoform sRAGE-delta; RAGE/AGER; RAGE1; RAGE-1; RAGE-4 ORF3; receptor for advanced glycation endproducts; receptor for advanced glycation end-products variant 20; receptor for advanced glycosylation end products; receptor of advanced glycosylation end products of proteins; immunoglobulin superfamily; MHC class II; MHC class III; renal cell carcinoma antigen; renal tumor antigen 1; SCARJ1; sRAGE; STK30
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 11596, 177, 81722
Content And Storage: -20°C
Form: Lyophilized
Applications: Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide, 0.05MG thimerosal
Gene Accession No.: Q15109, Q62151, Q63495
Gene Symbols: AGER
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human RAGE (174-192aa KEQTRRHPETGLFTLQSEL).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: AGO2
Classification: Polyclonal
Conjugate: Unconjugated
Gene: AGO2
Gene Alias: 1110029L17Rik; 2310051F07Rik; AGO1; AGO2; AI225898; AL022874; argonaute 2; argonaute 2, RISC catalytic component; argonaute RISC catalytic component 2; argonaute RISC catalytic subunit 2; Argonaute1; argonaute2; argonaute2 {ECO:0000255; AW546247; CTA-204B4.6; eIF2C; eIF2C 1; eIF-2C 1; eIF2C 2; eIF-2C 2; eIF2C 2 {ECO:0000255; eIF-2C 2 {ECO:0000255; EIF2C1; Eif2c2; ENSMUSG00000072493; Eukaryotic translation initiation factor 2C 2; eukaryotic translation initiation factor 2C 2 {ECO:0000255; eukaryotic translation initiation factor 2C, 2; GERp95; Gm10365; Golgi ER protein 95 kDa; hAgo1; hAgo2; HAMAP-Rule:MF_03031}; Kiaa4215; mAgo2; mKIAA4215; PAZ Piwi domain protein; Piwi/Argonaute family protein meIF2C2; PPD; Protein argonaute-1; protein argonaute-2; Protein slicer; Q10
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 239528, 27161, 59117
Content And Storage: -20°C
Form: Lyophilized
Applications: Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: Q8CJG0, Q9QZ81, Q9UKV8
Gene Symbols: AGO2
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Ago2/ eIF2C2 (129-169aa KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: AgRP
Classification: Polyclonal
Conjugate: Unconjugated
Gene: Agrp
Gene Alias: agouti related neuropeptide; agouti related protein; agouti related protein homolog; agouti-related protein; Agrp; AGRT; ART; ASIP2; orexigenic neuropeptide
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 11604, 181, 25582
Content And Storage: -20°C
Form: Lyophilized
Applications: Immunohistochemistry (Paraffin)
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: O00253, P56473
Gene Symbols: Agrp
Immunogen: E. coli-derived mouse AGRP recombinant protein (Position: S82-T131).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
