CYP27B1 Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA579128-Each-of-1 | In Stock | ₹ 42,737.22 |
PIPA579128 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 42,737.22
GST (18%): ₹ 7,692.70
Total Price: ₹ 50,429.92
Antigen
CYP27B1
Classification
Polyclonal
Conjugate
Unconjugated
Gene
CYP27B1
Gene Alias
1alpha(OH)ase; 25 hydroxyvitamin D3-1-alpha hydroxylase; 25(OH)D 1alpha-hydroxylase; 25-hydroxyvitamin D(3) 1-alpha-hydroxylase; 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial; 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial precursor (25-OHD-1 alpha-hydroxylase) (25-hydroxyvitamin D3 1-alpha-hydroxylase) (VD3 1A hydroxylase) (P450C1 alpha) (P450VD1-alpha); 25-hydroxyvitamin D3 1alpha-hydroxylase; 25-OHD-1 alpha-hydroxylase; Calcidiol 1-monooxygenase; Cp2b; cy; Cyp1; CYP1alpha; Cyp27b; Cyp27b1; Cyp40; cytochrome p450 27B1; cytochrome P450 40 (25-hydroxyvitamin D3 1 alpha-hydroxylase); cytochrome P450 family 27 subfamily B member 1; cytochrome P450 subfamily XXVIIB (25-hydroxyvitamin D-1-alpha-hydroxylase) polypeptide 1; cytochrome P450 subfamily XXVIIB polypeptide 1; cytochrome P450, 27b1; cytochrome P450, 40 (25-hydroxyvitamin D3 1 alpha-hydroxylase); cytochrome P450, family 27, subfamily B, polypeptide 1; cytochrome P450, subfamily 27b, polypeptide 1; cytochrome P450C1 alpha; Cytochrome P450VD1-alpha; P450c1; P450C1 alpha; P450VD1alpha; P450VD1-alpha; Pddr; VD3 1A hydroxylase; Vdd1; Vddr; VDDRI; VDR
Host Species
Rabbit
Purification Method
Antigen affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
114700, 13115, 1594
Content And Storage
-20°C
Form
Lyophilized
Applications
Immunohistochemistry (Paraffin), Western Blot
Concentration
500 μg/mL
Formulation
PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.
O15528, O35084, O35132
Gene Symbols
CYP27B1
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human CYP27B1 (475-508aa HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- CYP27B1 is a member of the cytochrome P450 superfamily of enzymes
- The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids
- The protein encoded by this gene localizes to the inner mitochondrial membrane where it hydroxylates 25-hydroxyvitamin D3 at the 1alpha position
- This reaction synthesizes 1alpha,25-dihydroxyvitamin D3, the active form of vitamin D3, which binds to the vitamin D receptor and regulates calcium metabolism
- Thus this enzyme regulates the level of biologically active vitamin D and plays an important role in calcium homeostasis
- Mutations in this gene can result in vitamin D-dependent rickets type I.
Compare Similar Items
Show Difference
Antigen: CYP27B1
Classification: Polyclonal
Conjugate: Unconjugated
Gene: CYP27B1
Gene Alias: 1alpha(OH)ase; 25 hydroxyvitamin D3-1-alpha hydroxylase; 25(OH)D 1alpha-hydroxylase; 25-hydroxyvitamin D(3) 1-alpha-hydroxylase; 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial; 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial precursor (25-OHD-1 alpha-hydroxylase) (25-hydroxyvitamin D3 1-alpha-hydroxylase) (VD3 1A hydroxylase) (P450C1 alpha) (P450VD1-alpha); 25-hydroxyvitamin D3 1alpha-hydroxylase; 25-OHD-1 alpha-hydroxylase; Calcidiol 1-monooxygenase; Cp2b; cy; Cyp1; CYP1alpha; Cyp27b; Cyp27b1; Cyp40; cytochrome p450 27B1; cytochrome P450 40 (25-hydroxyvitamin D3 1 alpha-hydroxylase); cytochrome P450 family 27 subfamily B member 1; cytochrome P450 subfamily XXVIIB (25-hydroxyvitamin D-1-alpha-hydroxylase) polypeptide 1; cytochrome P450 subfamily XXVIIB polypeptide 1; cytochrome P450, 27b1; cytochrome P450, 40 (25-hydroxyvitamin D3 1 alpha-hydroxylase); cytochrome P450, family 27, subfamily B, polypeptide 1; cytochrome P450, subfamily 27b, polypeptide 1; cytochrome P450C1 alpha; Cytochrome P450VD1-alpha; P450c1; P450C1 alpha; P450VD1alpha; P450VD1-alpha; Pddr; VD3 1A hydroxylase; Vdd1; Vddr; VDDRI; VDR
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 114700, 13115, 1594
Content And Storage: -20°C
Form: Lyophilized
Applications: Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: O15528, O35084, O35132
Gene Symbols: CYP27B1
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CYP27B1 (475-508aa HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: CYP2E1
Classification: Polyclonal
Conjugate: Unconjugated
Gene: Cyp2e1
Gene Alias: 4-nitrophenol 2-hydroxylase; CP2E1; CPE1; Cyp2e; Cyp2e1; Cyp2e-1; CYPIIE1; cytochrome P450 2E1; cytochrome P450 family 2 subfamily E member 1; cytochrome P450 subfamily 2e1 (ethanol-inducible); cytochrome P450, 2e1, ethanol inducible; cytochrome P450, family 2, subfamily e, polypeptide 1; cytochrome P450, subfamily 2E, polypeptide 1; cytochrome P450, subfamily IIE (ethanol-inducible), polypeptide 1; cytochrome P450-ALC; Cytochrome P450-J; cytochrome P450RLM6; flavoprotein-linked monooxygenase; microsomal monooxygenase; P450C2E; P450-J; P450RLM6; xenobiotic monooxygenase
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 13106, 1571, 25086
Content And Storage: -20°C
Form: Lyophilized
Applications: Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: P05181, P05182, Q05421
Gene Symbols: Cyp2e1
Immunogen: E.coli-derived human CYP2E1 recombinant protein (Position: M1-Y310).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: DAXX
Classification: Polyclonal
Conjugate: Unconjugated
Gene: DAXX
Gene Alias: BING2; CENP-C binding protein; DADB-159G18.9; DAP6; Daxx; death domain associated protein; Death domain-associated protein 6; death-associated protein 6; death-domain associated protein; EAP1; ETS1-associated protein 1; Fas death domain-associated protein; Fas-binding protein; hDaxx; MGC126245; MGC126246; SMIM40; Unknown (protein for MGC:138055)
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 13163, 140926, 1616
Content And Storage: -20°C
Form: Lyophilized
Applications: ChIP Assay, Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: O35613, Q8VIB2, Q9UER7
Gene Symbols: DAXX
Immunogen: E.coli-derived human Daxx recombinant protein (Position: K56-R345).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
