GSTA1/A2/A3/A4/A5 Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA579335-Each-of-1 | In Stock | ₹ 39,015.36 |
PIPA579335 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 39,015.36
GST (18%): ₹ 7,022.765
Total Price: ₹ 46,038.125
Antigen
GSTA1/A2/A3/A4/A5
Classification
Polyclonal
Conjugate
Unconjugated
Gene
Gsta3
Gene Alias
13-hydroperoxyoctadecadienoate peroxidase; Androst-5-ene-3,17-dione isomerase; GHS transferase; glutathione S-alkyltransferase A1; glutathione S-alkyltransferase A2; glutathione S-alkyltransferase A3; glutathione S-alkyltransferase A4; glutathione S-aralkyltransferase A2; glutathione S-aralkyltransferase A3; glutathione S-aralkyltransferase A4; glutathione S-aryltransferase A1; glutathione S-aryltransferase A2; glutathione S-aryltransferase A3; glutathione S-aryltransferase A4; glutathione S-transferase 2; glutathione S-transferase 5.7; Glutathione S-transferase A1; Glutathione S-transferase A1, N-terminally processed; Glutathione S-transferase A2; glutathione S-transferase A3; glutathione S-transferase A3 subunit; glutathione S-transferase A3-3; Glutathione S-transferase A4; glutathione S-transferase A4-4; Glutathione S-transferase A5; glutathione S-transferase A5-5; glutathione S-transferase alpha 1; glutathione S-transferase alpha 2; glutathione S-transferase alpha 3; glutathione S-transferase alpha 4; glutathione S-transferase alpha 5; glutathione S-transferase alpha-1; Glutathione S-transferase alpha-2; glutathione S-transferase alpha-3; Glutathione S-transferase alpha-4; glutathione S-transferase alpha-5; Glutathione S-transferase GT41A; glutathione S-transferase Ha subunit 1; glutathione S-transferase Ya; glutathione S-transferase Ya subunit; glutathione S-transferase Ya1; glutathione S-transferase Ya-1; Glutathione S-transferase Ya-2; Glutathione S-transferase Ya3; glutathione S-transferase Yc; Glutathione S-transferase Yc-1; glutathione S-transferase Yc1 subunit; Glutathione S-transferase Yc-2; glutathione S-transferase Yc2 subunit; glutathione S-transferase Yk; glutathione S-transferase, alpha 1 (Ya); glutathione S-transferase, alpha 2 (Yc2); glutathione S-transferase, alpha 3; glutathione S-transferase, alpha 4; glutathione transferase; glutathione transferase A4-4; glutathione transferase A5; glutathione transferase YA subunit; Glutathione-S-transferase alpha type (Ya); Glutathione-S-transferase alpha type (Yc?); glutathione-S-transferase, alpha type2; GST 1-1; GST 1a-1a; GST 1b-1b; GST 2-2; GST 5.7; GST 8-8; GST A1-1; GST A2-2; GST A3-3; GST A4-4; GST A5-5; GST AA; GST B; GST class-alpha member 1; GST class-alpha member 2; GST class-alpha member 3; GST class-alpha member 4; GST class-alpha member 5; GST HA subunit 1; GST HA subunit 2; GST K; GST Ya1; GST Ya2; GST Yc1; GST Yc2; GST Yk; GST2; Gst2-1; Gst2-2; Gst2-3; GST5.7; Gsta; Gsta1; GSTA1-1; Gsta2; GSTA2-2; GSTA3; GSTA3-3; GSTA4; GSTA4-4; Gsta5; Gstc2; Gstc-2; GST-epsilon; GST-gamma; Gstya; Gstyc; Gstyc1; Gstyc2; GTA2; GTA3; GTA4; GTH1; GTH2; Ligandin; liver GST2; mGsta4; OTTMUSG00000031890; S-(hydroxyalkyl)glutathione lyase A1; S-(hydroxyalkyl)glutathione lyase A2; S-(hydroxyalkyl)glutathione lyase A3; S-(hydroxyalkyl)glutathione lyase A4; testicular tissue protein Li 80; testis tissue sperm-binding protein Li 59n; Yc1; Yc2
Host Species
Rabbit
Purification Method
Antigen affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
100042314, 14857, 14858, 14859, 14860, 221357, 24421, 24422, 2938, 2939, 2940, 2941, 300850, 494499, 494500
Content And Storage
-20°C
Form
Lyophilized
Applications
ELISA, Immunohistochemistry (Paraffin), Western Blot
Concentration
500 μg/mL
Formulation
PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.
O15217, P00502, P04903, P04904, P08263, P09210, P10648, P13745, P14942, P24472, P30115, P46418, Q16772, Q7RTV2
Gene Symbols
GSTA1, GSTA2, Gsta3, Gsta4, Gsta5
Immunogen
E. coli-derived human GSTA1/A2/A3/A4/A5 recombinant protein (Position: A2-F222).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families
- These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione
- The genes encoding these enzymes are known to be highly polymorphic
- These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs
- At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta
- This gene encodes a glutathione S-transferase belonging to the alpha class
- The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver (hepatocytes) and kidney (proximal tubules)
- In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity, thereby protecting the cells from reactive oxygen species and the products of peroxidation.
Compare Similar Items
Show Difference
Antigen: GSTA1/A2/A3/A4/A5
Classification: Polyclonal
Conjugate: Unconjugated
Gene: Gsta3
Gene Alias: 13-hydroperoxyoctadecadienoate peroxidase; Androst-5-ene-3,17-dione isomerase; GHS transferase; glutathione S-alkyltransferase A1; glutathione S-alkyltransferase A2; glutathione S-alkyltransferase A3; glutathione S-alkyltransferase A4; glutathione S-aralkyltransferase A2; glutathione S-aralkyltransferase A3; glutathione S-aralkyltransferase A4; glutathione S-aryltransferase A1; glutathione S-aryltransferase A2; glutathione S-aryltransferase A3; glutathione S-aryltransferase A4; glutathione S-transferase 2; glutathione S-transferase 5.7; Glutathione S-transferase A1; Glutathione S-transferase A1, N-terminally processed; Glutathione S-transferase A2; glutathione S-transferase A3; glutathione S-transferase A3 subunit; glutathione S-transferase A3-3; Glutathione S-transferase A4; glutathione S-transferase A4-4; Glutathione S-transferase A5; glutathione S-transferase A5-5; glutathione S-transferase alpha 1; glutathione S-transferase alpha 2; glutathione S-transferase alpha 3; glutathione S-transferase alpha 4; glutathione S-transferase alpha 5; glutathione S-transferase alpha-1; Glutathione S-transferase alpha-2; glutathione S-transferase alpha-3; Glutathione S-transferase alpha-4; glutathione S-transferase alpha-5; Glutathione S-transferase GT41A; glutathione S-transferase Ha subunit 1; glutathione S-transferase Ya; glutathione S-transferase Ya subunit; glutathione S-transferase Ya1; glutathione S-transferase Ya-1; Glutathione S-transferase Ya-2; Glutathione S-transferase Ya3; glutathione S-transferase Yc; Glutathione S-transferase Yc-1; glutathione S-transferase Yc1 subunit; Glutathione S-transferase Yc-2; glutathione S-transferase Yc2 subunit; glutathione S-transferase Yk; glutathione S-transferase, alpha 1 (Ya); glutathione S-transferase, alpha 2 (Yc2); glutathione S-transferase, alpha 3; glutathione S-transferase, alpha 4; glutathione transferase; glutathione transferase A4-4; glutathione transferase A5; glutathione transferase YA subunit; Glutathione-S-transferase alpha type (Ya); Glutathione-S-transferase alpha type (Yc?); glutathione-S-transferase, alpha type2; GST 1-1; GST 1a-1a; GST 1b-1b; GST 2-2; GST 5.7; GST 8-8; GST A1-1; GST A2-2; GST A3-3; GST A4-4; GST A5-5; GST AA; GST B; GST class-alpha member 1; GST class-alpha member 2; GST class-alpha member 3; GST class-alpha member 4; GST class-alpha member 5; GST HA subunit 1; GST HA subunit 2; GST K; GST Ya1; GST Ya2; GST Yc1; GST Yc2; GST Yk; GST2; Gst2-1; Gst2-2; Gst2-3; GST5.7; Gsta; Gsta1; GSTA1-1; Gsta2; GSTA2-2; GSTA3; GSTA3-3; GSTA4; GSTA4-4; Gsta5; Gstc2; Gstc-2; GST-epsilon; GST-gamma; Gstya; Gstyc; Gstyc1; Gstyc2; GTA2; GTA3; GTA4; GTH1; GTH2; Ligandin; liver GST2; mGsta4; OTTMUSG00000031890; S-(hydroxyalkyl)glutathione lyase A1; S-(hydroxyalkyl)glutathione lyase A2; S-(hydroxyalkyl)glutathione lyase A3; S-(hydroxyalkyl)glutathione lyase A4; testicular tissue protein Li 80; testis tissue sperm-binding protein Li 59n; Yc1; Yc2
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 100042314, 14857, 14858, 14859, 14860, 221357, 24421, 24422, 2938, 2939, 2940, 2941, 300850, 494499, 494500
Content And Storage: -20°C
Form: Lyophilized
Applications: ELISA, Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: O15217, P00502, P04903, P04904, P08263, P09210, P10648, P13745, P14942, P24472, P30115, P46418, Q16772, Q7RTV2
Gene Symbols: GSTA1, GSTA2, Gsta3, Gsta4, Gsta5
Immunogen: E. coli-derived human GSTA1/A2/A3/A4/A5 recombinant protein (Position: A2-F222).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: GSTA1/A2/A3/A4/A5
Classification: Polyclonal
Conjugate: Unconjugated
Gene: Gsta3
Gene Alias: 13-hydroperoxyoctadecadienoate peroxidase; Androst-5-ene-3,17-dione isomerase; GHS transferase; glutathione S-alkyltransferase A1; glutathione S-alkyltransferase A2; glutathione S-alkyltransferase A3; glutathione S-alkyltransferase A4; glutathione S-aralkyltransferase A2; glutathione S-aralkyltransferase A3; glutathione S-aralkyltransferase A4; glutathione S-aryltransferase A1; glutathione S-aryltransferase A2; glutathione S-aryltransferase A3; glutathione S-aryltransferase A4; glutathione S-transferase 2; glutathione S-transferase 5.7; Glutathione S-transferase A1; Glutathione S-transferase A1, N-terminally processed; Glutathione S-transferase A2; glutathione S-transferase A3; glutathione S-transferase A3 subunit; glutathione S-transferase A3-3; Glutathione S-transferase A4; glutathione S-transferase A4-4; Glutathione S-transferase A5; glutathione S-transferase A5-5; glutathione S-transferase alpha 1; glutathione S-transferase alpha 2; glutathione S-transferase alpha 3; glutathione S-
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 100042314, 14857, 14858, 14859, 14860, 221357, 24421, 24422, 2938, 2939, 2940, 2941, 300850, 494499, 494500
Content And Storage: -20°C
Form: Lyophilized
Applications: Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: O15217, P00502, P04903, P04904, P08263, P09210, P10648, P13745, P14942, P24472, P30115, P46418, Q16772, Q7RTV2
Gene Symbols: GSTA1, GSTA2, Gsta3, Gsta4, Gsta5
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human GSTA1/A2/A3/A4/A5 (63-97aa MKLVQTRAILNYIASKYNLYGKDIKERALIDM YIE).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: GSTM1
Classification: Polyclonal
Conjugate: Unconjugated
Gene: GSTM1
Gene Alias: glutathione S-alkyltransferase; glutathione S-aralkyltransferase; glutathione S-aryltransferase; glutathione S-transferase GT8.7; glutathione S-transferase M1; glutathione S-transferase Mu 1; Glutathione S-transferase Yb-1; glutathione S-transferase Yb-1 subunit; glutathione S-transferase, mu 1; glutathione-S-transferase mu type 1 (Yb1); glutathione-S-transferase, mu 1; glutathione-S-transferase, mu type 1 (Yb1); GST 1-1; GST 3-3; GST class-mu 1; GST HB subunit 4; GST Yb1; GST1; GSTA3; Gstb1; Gstb-1; GSTM1; GSTM1-1; GSTM1a-1a; GSTM1b-1b; GTH4; GTM1; H-B; HB subunit 4; MU; MU-1; pmGT10; S-(hydroxyalkyl)glutathione lyase
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 14862, 24423, 2944
Content And Storage: -20°C
Form: Lyophilized
Applications: Flow Cytometry, Immunocytochemistry, Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: P04905, P09488, P10649
Gene Symbols: GSTM1
Immunogen: A synthetic peptide corresponding to a sequence of human GSTM1 (EEEKIRVDILENQTMDNHMQLGMICYNPEFEKLK).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG