hnRNP A1 Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA579381-Each-of-1 | In Stock | ₹ 39,015.36 |
PIPA579381 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 39,015.36
GST (18%): ₹ 7,022.765
Total Price: ₹ 46,038.125
Antigen
hnRNP A1
Classification
Polyclonal
Conjugate
Unconjugated
Gene
Hnrnpa1
Gene Alias
ALS19; ALS20; Fli-2; Hdp; HDP-1; Helix-destabilizing protein; heterogeneous nuclear ribonucleoprotein A1; Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed; heterogeneous nuclear ribonucleoprotein A1B protein; heterogeneous nuclear ribonucleoprotein B2 protein; heterogeneous nuclear ribonucleoprotein core protein A1; hnRNP A1; hnRNP A1-like 3; hnRNP core protein A1; hnRNP core protein A1-like 3; hnRNP I; Hnrnpa1; hnRNP-A1; HNRNPI; HNRNP-I; Hnrpa1; HNRPA1L3; HNRPA1MGC102835; HNRPI; I79_022927; IBMPFD3; MGC102835; MGC128297 protein; nuclear ribonucleoprotein particle A1 protein; pPTB; PTB; PTB-1; PTB2; PTB3; PTB4; PTB-T; putative heterogeneous nuclear ribonucleoprotein A1-like 3; Putative heterogeneous nuclear ribonucleoprotein A1-like protein 3; ROA1; RP11-78J21.1; single-strand DNA-binding protein UP1; single-strand RNA-binding protein; Single-strand-binding protein; Tis; Topoisomerase-inhibitor suppressed; unwinding protein 1; UP 1; UP1
Host Species
Rabbit
Purification Method
Antigen affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
15382, 29578, 3178
Content And Storage
-20°C
Form
Lyophilized
Applications
Flow Cytometry, Immunocytochemistry, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration
500 μg/mL
Formulation
PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.
P04256, P09651, P49312
Gene Symbols
Hnrnpa1
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human HnRNP A1 (8-42aa KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTD).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- HnRNP A1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs)
- The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA)
- These proteins are associated with pre mRNAs in the nucleus and appear to influence pre mRNA processing and other aspects of mRNA metabolism and transport
- While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm
- The hnRNP proteins have distinct nucleic acid binding properties
- hnRNP A1 has two repeats of quasi RRM domains that bind to RNAs
- It is one of the most abundant core proteins of hnRNP complexes and it is localized to the nucleoplasm
- This protein, along with other hnRNP proteins, is exported from the nucleus, probably bound to mRNA, and is immediately re imported.
Compare Similar Items
Show Difference
Antigen: hnRNP A1
Classification: Polyclonal
Conjugate: Unconjugated
Gene: Hnrnpa1
Gene Alias: ALS19; ALS20; Fli-2; Hdp; HDP-1; Helix-destabilizing protein; heterogeneous nuclear ribonucleoprotein A1; Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed; heterogeneous nuclear ribonucleoprotein A1B protein; heterogeneous nuclear ribonucleoprotein B2 protein; heterogeneous nuclear ribonucleoprotein core protein A1; hnRNP A1; hnRNP A1-like 3; hnRNP core protein A1; hnRNP core protein A1-like 3; hnRNP I; Hnrnpa1; hnRNP-A1; HNRNPI; HNRNP-I; Hnrpa1; HNRPA1L3; HNRPA1MGC102835; HNRPI; I79_022927; IBMPFD3; MGC102835; MGC128297 protein; nuclear ribonucleoprotein particle A1 protein; pPTB; PTB; PTB-1; PTB2; PTB3; PTB4; PTB-T; putative heterogeneous nuclear ribonucleoprotein A1-like 3; Putative heterogeneous nuclear ribonucleoprotein A1-like protein 3; ROA1; RP11-78J21.1; single-strand DNA-binding protein UP1; single-strand RNA-binding protein; Single-strand-binding protein; Tis; Topoisomerase-inhibitor suppressed; unwinding protein 1; UP 1; UP1
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 15382, 29578, 3178
Content And Storage: -20°C
Form: Lyophilized
Applications: Flow Cytometry, Immunocytochemistry, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: P04256, P09651, P49312
Gene Symbols: Hnrnpa1
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HnRNP A1 (8-42aa KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTD).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: hnRNP L
Classification: Polyclonal
Conjugate: Unconjugated
Gene: HNRNPL
Gene Alias: C79783; D830027H13Rik; Fblim1; FLJ35509; Heterogeneous nuclear ribonucleoprotein L; heterogenous nuclear ribonucleoprotein L; hnRNP L; Hnrnpl; hnRNP-L; Hnrpl; P/OKcl.14
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 15388, 3191, 80846
Content And Storage: -20°C
Form: Lyophilized
Applications: Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: F1LQ48, P14866, Q8R081
Gene Symbols: HNRNPL
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HnRNP L (546-571aa LLEWESKSDALETLGFLNHYQMKNPN).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: HOXA11
Classification: Polyclonal
Conjugate: Unconjugated
Gene: HOXA11
Gene Alias: homeo box 1I; homeo box A11; homeobox A11; homeobox protein Hox-1.9; Homeobox protein Hox-1I; homeobox protein HOXA11; homeobox protein Hox-A11; HOX1; Hox-1.9; HOX11; HOX1I; Hoxa11; Hoxa-11; NEWGENE_1564605; RUSAT1
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 103692131, 15396, 3207
Content And Storage: -20°C
Form: Lyophilized
Applications: Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Frozen), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: P31270, P31311
Gene Symbols: HOXA11
Immunogen: E.coli-derived human HOXA11 recombinant protein (Position: H74-R245).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
