MED4 Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA579659-Each-of-1 | In Stock | ₹ 39,015.36 |
PIPA579659 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 39,015.36
GST (18%): ₹ 7,022.765
Total Price: ₹ 46,038.125
Antigen
MED4
Classification
Polyclonal
Conjugate
Unconjugated
Gene
MED4
Gene Alias
2410046H15Rik; Activator-recruited cofactor 36 kDa component; ARC36; DRIP36; FLJ10956; HSPC126; hypothetical protein LOC550582; LOW QUALITY PROTEIN: mediator of RNA polymerase II transcription subunit 4; MED4; Mediator complex subunit 4; mediator of RNA polymerase II transcription subunit 4; mediator of RNA polymerase II transcription, subunit 4 homolog; mediator, 34-kD subunit, homolog; p36 TRAP/SMCC/PC2 subunit; RP11-90M2.2; TRAP/SMCC/PC2 subunit p36; TRAP/SMCC/PC2 subunit p36 subunit; TRAP36; Vdirp; Vdrip; vitamin D receptor interacting protein; vitamin D receptor-interacting protein, 36-kD; vitamin D3 receptor-interacting protein complex 36 kDa component; zgc:110646
Host Species
Rabbit
Purification Method
Antigen affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
29079, 306030, 67381
Content And Storage
-20°C
Form
Lyophilized
Applications
Immunohistochemistry (Paraffin), Western Blot
Concentration
500 μg/mL
Formulation
PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.
Q561Q8, Q9CQA5, Q9NPJ6
Gene Symbols
MED4
Immunogen
E. coli-derived human MED4 recombinant protein (Position: R27-K140).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- The Mediator is a multiprotein coactivator that is required by DNA-binding transcription factors for activation of polymerase II transcribed genes
- MED4 appears to be a core Mediator subunit and is found in nearly all Mediator preparations (Sato et al., 2004).
Compare Similar Items
Show Difference
Antigen: MED4
Classification: Polyclonal
Conjugate: Unconjugated
Gene: MED4
Gene Alias: 2410046H15Rik; Activator-recruited cofactor 36 kDa component; ARC36; DRIP36; FLJ10956; HSPC126; hypothetical protein LOC550582; LOW QUALITY PROTEIN: mediator of RNA polymerase II transcription subunit 4; MED4; Mediator complex subunit 4; mediator of RNA polymerase II transcription subunit 4; mediator of RNA polymerase II transcription, subunit 4 homolog; mediator, 34-kD subunit, homolog; p36 TRAP/SMCC/PC2 subunit; RP11-90M2.2; TRAP/SMCC/PC2 subunit p36; TRAP/SMCC/PC2 subunit p36 subunit; TRAP36; Vdirp; Vdrip; vitamin D receptor interacting protein; vitamin D receptor-interacting protein, 36-kD; vitamin D3 receptor-interacting protein complex 36 kDa component; zgc:110646
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 29079, 306030, 67381
Content And Storage: -20°C
Form: Lyophilized
Applications: Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: Q561Q8, Q9CQA5, Q9NPJ6
Gene Symbols: MED4
Immunogen: E. coli-derived human MED4 recombinant protein (Position: R27-K140).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: MED9
Classification: Polyclonal
Conjugate: Unconjugated
Gene: Med9
Gene Alias: BC019367; Med25; Med9; Mediator complex subunit 9; mediator of RNA polymerase II transcription subunit 9; mediator of RNA polymerase II transcription, subunit 9 homolog; mediator subunit 25; RGD1563669
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 192191, 497914, 55090
Content And Storage: -20°C
Form: Lyophilized
Applications: Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: Q8VCS6, Q9NWA0
Gene Symbols: Med9
Immunogen: E. coli-derived human MED9 recombinant protein (Position: A55-E146).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: MEFV
Classification: Polyclonal
Conjugate: Unconjugated
Gene: MEFV
Gene Alias: FMF; HGNC:6998; Marenostrin; Mediterranean fever; MEF; MEFV; MGC126560; MGC126586; Pyrin; TRIM20
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 4210, 58923
Content And Storage: -20°C
Form: Lyophilized
Applications: Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: O15553, Q9JJ25
Gene Symbols: MEFV
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MEFV (5-39aa PSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSR).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Rat
Product Type: Antibody
Isotype: IgG
