NME1 Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA579743-Each-of-1 | In Stock | ₹ 38,844.24 |
PIPA579743 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 38,844.24
GST (18%): ₹ 6,991.963
Total Price: ₹ 45,836.203
Antigen
NME1
Classification
Polyclonal
Conjugate
Unconjugated
Gene
NME1
Gene Alias
AL024257; AWD; expressed in non-metastatic cells 1; expressed in non-metastatic cells 1 protein; expressed in non-metastatic cells 1 protein (NM23A) (nucleoside diphosphate kinase); expressed in non-metastatic cells 1, protein; expressed in non-metastatic cells 1, protein (NM23A) (nucleoside diphosphate kinase); GAAD; Granzyme A activated DNase (GAAD); Granzyme A-activated DNase; GZMA activated DNase; included; metastasis inhibition factor NM23; NB; NBR-A; NBR-B; NBS; NDK A; NDK A 1; NDK A 2; NDK NBR-A; NDK NBR-B; NDKA; NDP kinase A; NDP kinase A 1; NDP kinase A 2; NDP kinase beta; NDP kinase NBR-A; NDPKA; NDPK-A; NM23; NM23A; NM23-C1; NM23-H1; NM23H1B; nm23-M1; NME/NM23 nucleoside diphosphate kinase 1; Nme1; NME1-1; NME1-NME2 spliced read-through transcript; non-metastatic cells 1, protein (NM23A) expressed in; nucleoside diphosphate kinase A; nucleoside diphosphate kinase A 1; nucleoside diphosphate kinase A 2; nucleoside diphosphate kinase NBR-B; nucleoside-diphosphate kinase 1; nuc
Host Species
Rabbit
Purification Method
Antigen affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
18102, 191575, 4830
Content And Storage
-20°C
Form
Lyophilized
Applications
Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Frozen), Western Blot
Concentration
500 μg/mL
Formulation
PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.
P15531, P15532, Q05982
Gene Symbols
NME1
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human NM23A (26-58aa KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- NME1 was identified because of its reduced mRNA transcript levels in highly metastatic cells
- Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms
- Mutations in the gene have been identified in aggressive neuroblastomas
- Two transcript variants encoding different isoforms have been found for this gene
- Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.
Compare Similar Items
Show Difference
Antigen: NME1
Classification: Polyclonal
Conjugate: Unconjugated
Gene: NME1
Gene Alias: AL024257; AWD; expressed in non-metastatic cells 1; expressed in non-metastatic cells 1 protein; expressed in non-metastatic cells 1 protein (NM23A) (nucleoside diphosphate kinase); expressed in non-metastatic cells 1, protein; expressed in non-metastatic cells 1, protein (NM23A) (nucleoside diphosphate kinase); GAAD; Granzyme A activated DNase (GAAD); Granzyme A-activated DNase; GZMA activated DNase; included; metastasis inhibition factor NM23; NB; NBR-A; NBR-B; NBS; NDK A; NDK A 1; NDK A 2; NDK NBR-A; NDK NBR-B; NDKA; NDP kinase A; NDP kinase A 1; NDP kinase A 2; NDP kinase beta; NDP kinase NBR-A; NDPKA; NDPK-A; NM23; NM23A; NM23-C1; NM23-H1; NM23H1B; nm23-M1; NME/NM23 nucleoside diphosphate kinase 1; Nme1; NME1-1; NME1-NME2 spliced read-through transcript; non-metastatic cells 1, protein (NM23A) expressed in; nucleoside diphosphate kinase A; nucleoside diphosphate kinase A 1; nucleoside diphosphate kinase A 2; nucleoside diphosphate kinase NBR-B; nucleoside-diphosphate kinase 1; nuc
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 18102, 191575, 4830
Content And Storage: -20°C
Form: Lyophilized
Applications: Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Frozen), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: P15531, P15532, Q05982
Gene Symbols: NME1
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human NM23A (26-58aa KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: NME2
Classification: Polyclonal
Conjugate: Unconjugated
Gene: NME2
Gene Alias: 2.7.13.3; c-myc purine-binding transcription factor PUF; c-myc transcription factor; epididymis secretory sperm binding protein Li 155an; expressed in non-metastatic cells 2; expressed in non-metastatic cells 2 protein; HEL-S-155an; histidine protein kinase NDKB; NDK B; NDKB; NDP kinase alpha; NDP kinase B; NDPKB; NDPK-B; nm23-2; NM23B; nm23-H2; nm23-M2; NME/NM23 nucleoside diphosphate kinase 2; Nme2; non-metastatic cells 2, protein (NM23) expressed in; non-metastatic cells 2, protein (NM23B) expressed in; nucleoside diphosphate kinase B; nucleoside-diphosphate kinase 2; nucleotide diphosphate kinase B; P18; p18-12d; PUF
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 18103, 4831, 83782
Content And Storage: -20°C
Form: Lyophilized
Applications: Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide, 0.05MG thimerosal
Gene Accession No.: P19804, P22392, Q01768
Gene Symbols: NME2
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human NME2 (137-152aa EELVDYKSCAHDWVYE).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: NMI
Classification: Polyclonal
Conjugate: Unconjugated
Gene: NMI
Gene Alias: N-mcy (and STAT) interactor; Nmi; N-myc (and STAT) interactor; N-myc and STAT interactor; N-myc interactor; N-myc-interactor
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 9111
Content And Storage: -20°C
Form: Lyophilized
Applications: Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: Q13287
Gene Symbols: NMI
Immunogen: E.coli-derived human NMI recombinant protein (Position: E2-E307).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Product Type: Antibody
Isotype: IgG
