Classification:
Polyclonal
Gene Alias:
bile acid cotransporting polypeptide; cell growth-inhibiting gene 29 protein; GIG29; growth-inhibiting protein 29; hepatic sodium-dependent bile acid transporter; LOW QUALITY PROTEIN: sodium/bile acid cotransporter; MGC128766 protein; Na(+)/bile acid cotransporter; Na(+)/taurocholate transport protein; Na/taurocholate cotransporting polypeptide; NA-dependent cholate transporting protein; Ntcp; Ntcp1; SBACT; Slc10a1; sodium bile acid cotransporting polypeptide; sodium/bile acid cotransporter; sodium/tauro; sodium/taurocholate cotransporter; sodium/taurocholate cotransporting polypeptide; sodium-dependent bile acid cotransporter; sodium-dependent taurocholate cotransporting polypeptide; sodium-taurocholate cotransporting polypeptide; solute carrier family 10 (sodium/bile acid cotransporter family), member 1; solute carrier family 10 (sodium/bile acid cotransporter), member 1; solute carrier family 10 member 1; solute carrier family 10, member 1
Purification Method:
Antigen affinity chromatography
Gene ID (Entrez):
20493, 24777
Content And Storage:
-20°C
Applications:
Flow Cytometry, Immunohistochemistry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot
Formulation:
PBS with 4MG trehalose and no preservative
Gene Accession No.:
O08705, P26435
Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of mouse SLC10A1 (296-336aa EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK).
Primary or Secondary:
Primary
Target Species:
Mouse, Rat