TAP1 Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA580094-Each-of-1 | In Stock | ₹ 39,785.40 |
PIPA580094 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 39,785.40
GST (18%): ₹ 7,161.372
Total Price: ₹ 46,946.772
Antigen
TAP1
Classification
Polyclonal
Conjugate
Unconjugated
Gene
TAP1
Gene Alias
ABC transporter, MHC 1; ABC transporter, MHC, 1; ABC17; ABCB2; ABP-278; ABP-280; ABP-280 homolog; Antigen peptide transporter 1; AOI; APT1; ATP dependent transport protein family member; ATP-binding cassette sub-family B member 2; ATP-binding cassette transporter, major histocompatibility complex, 1; ATP-binding cassette, sub-family B (MDR/TAP), member 2; beta-filamin; Cim; D6S114E; DAAP-57C1.5; FH1; filamin homolog 1; filamin-3; filamin-B; FLJ26666; FLJ41500; FLN1L; FLN-B; Ham1; Ham-1; Histocompatibility antigen modifier 1; LRS1; MTP1; Peptide supply factor 1; peptide transporter involved in antigen processing 1; Peptide transporter PSF1; peptide transporter TAP1; PSF1; PSF-1; Really interesting new gene 4 protein; RING4; SCT; TABP; TAP; tap i; TAP1; Tap-1; TAP1*0102N; TAP1N; Tap2; thyroid autoantigen; transporter 1 ABC (ATP binding cassette); transporter 1 ATP-binding cassette sub-family B; transporter 1, ABC (ATP binding cassette); transporter 1, ATP binding cassette subfamily B member; transporter 1, ATP-binding cassette, sub-family B (MDR/TAP); transporter associated with antigen processing; transporter associated with antigen processing 1; transporter, ABC, MHC, 1; transporter, ATP-binding cassette, major histocompatibility complex, 1; Y3
Host Species
Rabbit
Purification Method
Antigen affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
6890
Content And Storage
-20°C
Form
Lyophilized
Applications
Immunohistochemistry (Paraffin), Western Blot
Concentration
500 μg/mL
Formulation
PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.
Q03518
Gene Symbols
TAP1
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human TAP1 (438-471aa RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters
- ABC proteins transport various molecules across extra- and intra-cellular membranes
- ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White)
- This protein is a member of the MDR/TAP subfamily
- Members of the MDR/TAP subfamily are involved in multidrug resistance
- The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble
- Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease.
Compare Similar Items
Show Difference
Antigen: TAP1
Classification: Polyclonal
Conjugate: Unconjugated
Gene: TAP1
Gene Alias: ABC transporter, MHC 1; ABC transporter, MHC, 1; ABC17; ABCB2; ABP-278; ABP-280; ABP-280 homolog; Antigen peptide transporter 1; AOI; APT1; ATP dependent transport protein family member; ATP-binding cassette sub-family B member 2; ATP-binding cassette transporter, major histocompatibility complex, 1; ATP-binding cassette, sub-family B (MDR/TAP), member 2; beta-filamin; Cim; D6S114E; DAAP-57C1.5; FH1; filamin homolog 1; filamin-3; filamin-B; FLJ26666; FLJ41500; FLN1L; FLN-B; Ham1; Ham-1; Histocompatibility antigen modifier 1; LRS1; MTP1; Peptide supply factor 1; peptide transporter involved in antigen processing 1; Peptide transporter PSF1; peptide transporter TAP1; PSF1; PSF-1; Really interesting new gene 4 protein; RING4; SCT; TABP; TAP; tap i; TAP1; Tap-1; TAP1*0102N; TAP1N; Tap2; thyroid autoantigen; transporter 1 ABC (ATP binding cassette); transporter 1 ATP-binding cassette sub-family B; transporter 1, ABC (ATP binding cassette); transporter 1, ATP binding cassette subfamily B member; transporter 1, ATP-binding cassette, sub-family B (MDR/TAP); transporter associated with antigen processing; transporter associated with antigen processing 1; transporter, ABC, MHC, 1; transporter, ATP-binding cassette, major histocompatibility complex, 1; Y3
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 6890
Content And Storage: -20°C
Form: Lyophilized
Applications: Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: Q03518
Gene Symbols: TAP1
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human TAP1 (438-471aa RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Product Type: Antibody
Isotype: IgG
Antigen: TAT
Classification: Polyclonal
Conjugate: Unconjugated
Gene: TAT
Gene Alias: 2.6.1.5; L-tyrosine:2-oxoglutarate aminotransferase; Tat; testis tissue sperm-binding protein Li 34a; tyrosine aminotransferase; tyrosine aminotransferase, cytosolic; tyrosine transaminase
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 234724, 24813, 6898
Content And Storage: -20°C
Form: Lyophilized
Applications: Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: P04694, P17735, Q8QZR1
Gene Symbols: TAT
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ATTY (169-208aa FSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLIDEK).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: TBP
Classification: Polyclonal
Conjugate: Unconjugated
Gene: Tbp
Gene Alias: Gtf2d; GTF2D1; HDL4; MGC117320; MGC126054; MGC126055; RP1-191N21.3; SCA17; TATA binding protein; TA-TA binding protein 1; TATA box binding protein; TATA sequence-binding protein; TATA-binding factor; TATA-binding protein; TATA-box binding protein; TATA-box binding protein N-terminal domain; TATA-box factor; tata-box-binding; TATA-box-binding protein; TBP; TBP0; TBP1; TF2D; TFIID; TFIID core protein; transcription initiation factor TFIID TBP subunit; Unknown (protein for MGC:138100)
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 117526, 21374, 6908
Content And Storage: -20°C
Form: Lyophilized
Applications: Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide, 0.05MG thimerosal
Gene Accession No.: P20226, P29037
Gene Symbols: Tbp
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human TBP (227-246aa EEQSRLAARKYARVVQKLGF).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
