Pokemon Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA580247-Each-of-1 | In Stock | ₹ 40,406.00 |
PIPA580247 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 40,406.00
GST (18%): ₹ 7,273.08
Total Price: ₹ 47,679.08
Antigen
Pokemon
Classification
Polyclonal
Conjugate
Unconjugated
Gene
ZBTB7A
Gene Alias
9030619K07Rik; 9130006G12Rik; AI452336; cLRF; DKFZp547O146; factor binding IST protein 1; Factor that binds to inducer of short transcripts protein 1; FBI1; FBI-1; HIV-1 1st-binding protein 1; HIV-1 inducer of short transcripts binding protein; leukemia/lymohoma related factor cLRF; leukemia/lymphoma related factor; leukemia/lymphoma related factor cLRF; leukemia/lymphoma-related factor; LRF; lymphoma related factor; MGC99631; Oczf; Osteoclast-derived zinc finger protein; POK erythroid myeloid ontogenic factor; Pokemon; POZ and Krueppel erythroid myeloid ontogenic factor; TIP21; TTF-I-interacting peptide 21; Zbtb7; ZBTB7A; zi; zinc finger and BTB domain containing 7a; zinc finger and BTB domain containing 7A, HIV-1 inducer of short transcripts binding protein; zinc finger and BTB domain-containing protein 7A; Zinc finger protein 857A; ZNF857A
Host Species
Rabbit
Purification Method
Antigen affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
51341
Content And Storage
-20°C
Form
Lyophilized
Applications
Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration
500 μg/mL
Formulation
PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.
O95365
Gene Symbols
ZBTB7A
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ZBTB7A (125-163aa DLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEF).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- Plays a key role in the instruction of early lymphoid progenitors to develop into B lineage by repressing T-cell instructive Notch signals
- Specifically represses the transcription of the CDKN2A gene
- Efficiently abrogates E2F1-dependent CDKN2A transactivation/de-repression
- Binds to the consensus sequence 5'-[GA][CA]GACCCCCCCCC-3'.
Compare Similar Items
Show Difference
Antigen: Pokemon
Classification: Polyclonal
Conjugate: Unconjugated
Gene: ZBTB7A
Gene Alias: 9030619K07Rik; 9130006G12Rik; AI452336; cLRF; DKFZp547O146; factor binding IST protein 1; Factor that binds to inducer of short transcripts protein 1; FBI1; FBI-1; HIV-1 1st-binding protein 1; HIV-1 inducer of short transcripts binding protein; leukemia/lymohoma related factor cLRF; leukemia/lymphoma related factor; leukemia/lymphoma related factor cLRF; leukemia/lymphoma-related factor; LRF; lymphoma related factor; MGC99631; Oczf; Osteoclast-derived zinc finger protein; POK erythroid myeloid ontogenic factor; Pokemon; POZ and Krueppel erythroid myeloid ontogenic factor; TIP21; TTF-I-interacting peptide 21; Zbtb7; ZBTB7A; zi; zinc finger and BTB domain containing 7a; zinc finger and BTB domain containing 7A, HIV-1 inducer of short transcripts binding protein; zinc finger and BTB domain-containing protein 7A; Zinc finger protein 857A; ZNF857A
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 51341
Content And Storage: -20°C
Form: Lyophilized
Applications: Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: O95365
Gene Symbols: ZBTB7A
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ZBTB7A (125-163aa DLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEF).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Product Type: Antibody
Isotype: IgG
Antigen: ZP2
Classification: Polyclonal
Conjugate: Unconjugated
Gene: Zp2
Gene Alias: 75-kDa rabbit zona pellucida protein; Processed zona pellucida sperm-binding protein 2; zona pellucida 2 glycoprotein; zona pellucida A protein; zona pellucida glycoprotein 2; zona pellucida glycoprotein 2 (sperm receptor); zona pellucida glycoprotein ZP2; zona pellucida glycoprotein ZPA; zona pellucida protein A; Zona pellucida sperm-binding protein 2; ZP2; Zp-2; ZPA
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 7783
Content And Storage: -20°C
Form: Lyophilized
Applications: Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: Q05996
Gene Symbols: Zp2
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ZP2 (511-544aa ENEYPLVRFLRQPIYMEVRVLNRDDPNIKLVLDD).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Product Type: Antibody
Isotype: IgG
Antigen: ZWINT
Classification: Polyclonal
Conjugate: Unconjugated
Gene: ZWINT
Gene Alias: 2010007E07Rik; 2600001N01Rik; D10Ertd749e; human ZW10 interacting protein-1; HZwint-1; KNTC2AP; neuroprotective protein 8; scoilin; Sip30; SNAP25 interacting protein 30; SNAP25 interacting protein of 30 kDa; SNAP25-interacting protein 30; ZW10 interacting kinetochore protein; ZW10 interacting protein-1; ZW10 interactor; ZW10 interactor, kinetochore protein; ZW10-interacting protein 1; ZWINT; ZWINT1; Zwint-1
Host Species: Rabbit
Purification Method: Antigen affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 11130, 257644, 52696
Content And Storage: -20°C
Form: Lyophilized
Applications: Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: O95229, Q8VIL3, Q9CQU5
Gene Symbols: ZWINT
Immunogen: E.coli-derived human ZWINT recombinant protein (Position: Q29-Q249).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
