Osteopontin Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA594926-Each-of-1 | In Stock | ₹ 44,277.30 |
PIPA594926 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 44,277.30
GST (18%): ₹ 7,969.914
Total Price: ₹ 52,247.214
Antigen
Osteopontin
Classification
Polyclonal
Conjugate
Unconjugated
Gene
SPP1
Gene Alias
2AR, 2b7, 44 kDa bone phosphoprotein, Apl-1, BNSP, Bone sialoprotein 1, Bone sialoprotein 1 (BSPI/BSP1), Bsp, BSPI, Calcium oxalate crystal growth inhibitor protein, CALPHA1 fusion, Early T lymphocyte activation 1 (ETA1), early T-lymphocyte activation 1, early T-lymphocyte activation 1 protein, Eta, ETA-1, HGNC:11255, immunoglobulin alpha 1 heavy chain constant region fusion protein, MGC110940, Minopontin, nephropontin, Op, Opn, Opnl, OSP, osteopontin, osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein, osteopontin-like protein, PSEC0156, Ric, Secreted phosphoprotein 1, secreted phosphoprotein 1 (osteopontin bone sialoprotein I early T lymphocyte activation 1), secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1), Secreted phosphoprotein 1 (SPP1), secreted phosphoprotein 1 variant 6, Sialoprotein (osteopontin), SPP1, SPP-1, SPP1/CALPHA1 fusion, unnamed protein product, urinar, urinary stone protein, Uropontin
Host Species
Rabbit
Purification Method
Affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
20750, 25353, 6696
Content And Storage
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form
Lyophilized
Applications
ELISA, Western Blot
Concentration
500 μg/mL
Formulation
PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.
P08721, P10451, P10923
Gene Symbols
SPP1
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Osteopontin (281-314aa HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- Osteopontin is an arginine-glycine-aspartic acid (RGD)-containing glycoprotein that interacts with integrins and CD44 as major receptors
- It is a multifunctional protein involved in bone mineralization, cell adhesion, cell migration, chronic inflammatory disease and transformation
- Proteolytic cleavage by thrombin and matrix metalloproteinases close to the integrin-binding Arg-Gly-Asp sequence modulates the function of OPN and its integrin binding properties
- Thrombin-cleaved fragments of Osteopontin are overexpressed in malignant glial tumors and provide a molecular niche with survival advantage and provide a novel substrate for plasmin and cathepsin D.
Compare Similar Items
Show Difference
Antigen: Osteopontin
Classification: Polyclonal
Conjugate: Unconjugated
Gene: SPP1
Gene Alias: 2AR, 2b7, 44 kDa bone phosphoprotein, Apl-1, BNSP, Bone sialoprotein 1, Bone sialoprotein 1 (BSPI/BSP1), Bsp, BSPI, Calcium oxalate crystal growth inhibitor protein, CALPHA1 fusion, Early T lymphocyte activation 1 (ETA1), early T-lymphocyte activation 1, early T-lymphocyte activation 1 protein, Eta, ETA-1, HGNC:11255, immunoglobulin alpha 1 heavy chain constant region fusion protein, MGC110940, Minopontin, nephropontin, Op, Opn, Opnl, OSP, osteopontin, osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein, osteopontin-like protein, PSEC0156, Ric, Secreted phosphoprotein 1, secreted phosphoprotein 1 (osteopontin bone sialoprotein I early T lymphocyte activation 1), secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1), Secreted phosphoprotein 1 (SPP1), secreted phosphoprotein 1 variant 6, Sialoprotein (osteopontin), SPP1, SPP-1, SPP1/CALPHA1 fusion, unnamed protein product, urinar, urinary stone protein, Uropontin
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 20750, 25353, 6696
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form: Lyophilized
Applications: ELISA, Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: P08721, P10451, P10923
Gene Symbols: SPP1
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Osteopontin (281-314aa HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: Livin
Classification: Polyclonal
Conjugate: Unconjugated
Gene: BIRC7
Gene Alias: baculoviral IAP repeat containing 7, baculoviral IAP repeat-containing 7, baculoviral IAP repeat-containing 7 (livin), baculoviral IAP repeat-containing protein 7, Baculoviral IAP repeat-containing protein 7 30 kDa subunit, Baculoviral IAP repeat-containing protein 7 30kDa subunit, Birc7, E130019N06, KIAP, Kidney inhibitor of apoptosis protein, LIVIN, livin inhibitor of apoptosis, melanoma inhibitor of apoptosis protein, MLIAP, ML-IAP, RGD1562883, RING finger protein 50, RING-type E3 ubiquitin transferase BIRC7, RNF50, RP11-261N11.7, Truncated livin, UNQ5800/PRO19607/PRO21344
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 79444
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form: Lyophilized
Applications: ELISA, Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: Q96CA5
Gene Symbols: BIRC7
Immunogen: E.coli-derived human Livin recombinant protein (Position: E87-S298).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Product Type: Antibody
Isotype: IgG
Antigen: PTOV1
Classification: Polyclonal
Conjugate: Unconjugated
Gene: PTOV1
Gene Alias: 1110030G05Rik, ACID2, Activator interaction domain-containing protein 2, AU041779, Gcap3, granule cell antiserum positive 3, PP642, prostate tumor over expressed gene 1, prostate tumor overexpressed 1, prostate tumor-overexpressed gene 1 protein, Prostate tumor-overexpressed gene 1 protein homolog, Ptov1, PTOV-1, UNQ6127/PRO20092
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 292888, 53635
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form: Lyophilized
Applications: Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: Q5U2W6, Q86YD1
Gene Symbols: PTOV1
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PTOV1 (385-414aa NFVNGIRRVIANQQQVLQRNLEQEQQQRGM).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Rat
Product Type: Antibody
Isotype: IgG
