IDH1 Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA595289-Each-of-1 | In Stock | ₹ 44,705.10 |
PIPA595289 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 44,705.10
GST (18%): ₹ 8,046.918
Total Price: ₹ 52,752.018
Antigen
IDH1
Classification
Polyclonal
Conjugate
Unconjugated
Gene
IDH1
Gene Alias
AI314845, AI788952, cb876, corneal epithelial crystallin, cytosolic NADP+-dependent isocitrate dehydrogenase, cytosolic NADP-isocitrate dehydrogenase, cytosolic NADP-isocitrate dehydrongenase, E030024J03Rik, epididymis luminal protein 216, epididymis secretory protein Li 26, fm90e09, HEL-216, HEL-S-26, ICDH, Id-1, IDCD, IDH, Idh1, Idh-1, IDP, Idpc, im:7143416, isocitrate dehydrogenase (NAD(+)) IDH1, isocitrate dehydrogenase (NADP(+)) 1, isocitrate dehydrogenase (NADP(+)) 1, cytosolic, Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial, Isocitrate dehydrogenase [NADP] cytoplasmic, isocitrate dehydrogenase 1 (NADP+), isocitrate dehydrogenase 1 (NADP+), soluble, Isocitrate dehydrogenase 1, soluble, Isocitric dehydrogenase, N2690, NAD(+)-specific ICDH, NADP(+)-specific ICDH, NADP+-specific ICDH, NADP-cICDH, NADP-dependent isocitrate dehydrogenase, cytosolic, NADP-dependent isocitrate dehydrogenase, peroxisomal, OTTHUMP00000206464, OTTHUMP00000206465, OTTHUMP00000206466, oxalosuccinate decarboxylase, PICD, wu:fm90e09, YNL037C
Host Species
Rabbit
Purification Method
Affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
15926, 24479, 3417
Content And Storage
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form
Lyophilized
Applications
Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot
Concentration
500 μg/mL
Formulation
PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.
O75874, O88844, P41562
Gene Symbols
IDH1
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human IDH1 (381-413aa KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate
- These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+)
- Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic
- Each NADP(+)-dependent isozyme is a homodimer
- The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes
- It contains the PTS-1 peroxisomal targeting signal sequence
- The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid
- The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production.
Compare Similar Items
Show Difference
Antigen: IDH1
Classification: Polyclonal
Conjugate: Unconjugated
Gene: IDH1
Gene Alias: AI314845, AI788952, cb876, corneal epithelial crystallin, cytosolic NADP+-dependent isocitrate dehydrogenase, cytosolic NADP-isocitrate dehydrogenase, cytosolic NADP-isocitrate dehydrongenase, E030024J03Rik, epididymis luminal protein 216, epididymis secretory protein Li 26, fm90e09, HEL-216, HEL-S-26, ICDH, Id-1, IDCD, IDH, Idh1, Idh-1, IDP, Idpc, im:7143416, isocitrate dehydrogenase (NAD(+)) IDH1, isocitrate dehydrogenase (NADP(+)) 1, isocitrate dehydrogenase (NADP(+)) 1, cytosolic, Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial, Isocitrate dehydrogenase [NADP] cytoplasmic, isocitrate dehydrogenase 1 (NADP+), isocitrate dehydrogenase 1 (NADP+), soluble, Isocitrate dehydrogenase 1, soluble, Isocitric dehydrogenase, N2690, NAD(+)-specific ICDH, NADP(+)-specific ICDH, NADP+-specific ICDH, NADP-cICDH, NADP-dependent isocitrate dehydrogenase, cytosolic, NADP-dependent isocitrate dehydrogenase, peroxisomal, OTTHUMP00000206464, OTTHUMP00000206465, OTTHUMP00000206466, oxalosuccinate decarboxylase, PICD, wu:fm90e09, YNL037C
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 15926, 24479, 3417
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form: Lyophilized
Applications: Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: O75874, O88844, P41562
Gene Symbols: IDH1
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IDH1 (381-413aa KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: SOX4
Classification: Polyclonal
Conjugate: Unconjugated
Gene: SOX4
Gene Alias: AA682046, ecotropic viral integration site 16, EVI16, SOX4, Sox-4, SRY (sex determining region Y)-box 4, SRY box 4, SRY-box 4, SRY-box containing gene 4, SRY-box transcription factor 4, SRY-related HMG-box gene 4, transcription factor SOX-4
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 20677, 6659
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form: Lyophilized
Applications: Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: Q06831, Q06945
Gene Symbols: SOX4
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SOX4 (1-31aa MVQQTNNAENTEALLAGESSDSGAGLELGIA).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse
Product Type: Antibody
Isotype: IgG
Antigen: Cofilin
Classification: Polyclonal
Conjugate: Unconjugated
Gene: CFL1
Gene Alias: 18 kDa phosphoprotein, AA959946, CFL, Cfl1, CFL-1, Cof, COF1, cofilin, cofilin 1, cofilin 1 (non-muscle), cofilin 1, non-muscle, cofilin, non-muscle isoform, Cofilin1, Cofilin-1, cofilin-1-like protein, epididymis secretory protein Li 15, HEL-S-15, n-cofilin, p18
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 1072, 12631, 29271
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form: Lyophilized
Applications: Immunocytochemistry, Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 5MG BSA and 0.05MG sodium azide
Gene Accession No.: P18760, P23528, P45592
Gene Symbols: CFL1
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cofilin (122-152aa DAIKKKLTGIKHELQANCYEEVKDRCTLAEK).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Non-human Primate, Rat
Product Type: Antibody
Isotype: IgG
