Calcitonin Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA595529-Each-of-1 | In Stock | ₹ 44,705.10 |
PIPA595529 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 44,705.10
GST (18%): ₹ 8,046.918
Total Price: ₹ 52,752.018
Antigen
Calcitonin
Classification
Polyclonal
Conjugate
Unconjugated
Gene
CALCA
Gene Alias
Alpha CGRP, Alpha type CGRP, Alpha-type CGRP, CA, Cal1, CAL6, CALC, CALC1, Calca, Calcitonin, calcitonin 1, Calcitonin carboxyl-terminal peptide, calcitonin gene related peptide 1, calcitonin gene related peptide I, calcitonin gene related peptide I precursor, Calcitonin gene-related peptide, calcitonin gene-related peptide 1, Calcitonin gene-related peptide I, calcitonin precursor, calcitonin related polypeptide alpha, calcitonin/calcitonin-related polypeptide, alpha, calcitonin, calcitonin gene-related peptide 1, calcitonin-like, calcitonin-related polypeptide alpha, CCALCI, CCP, Cgrp, CGRP1, CGRP-1, CGRPI, CGRP-I, CT, Ctn, katacalcin, katacalcin (KC), KC, PCT, PDN-21, prepro-alpha-calcitonin gene-related peptide, procalcitonin, RATCAL6
Host Species
Rabbit
Purification Method
Affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
12310, 24241, 796
Content And Storage
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form
Lyophilized
Applications
Immunohistochemistry (Paraffin)
Concentration
500 μg/mL
Formulation
PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.
P01256, P01257, P01258, P06881, P70160
Gene Symbols
CALCA
Immunogen
A synthetic peptide corresponding to a sequence of mouse Calcitonin (CGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAP).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- Calcitonin is a 32 amino acid peptide which can be demonstrated in C cells of the normal and hyperplastic thyroid
- Staining for calcitonin may be used for the identification of a spectrum of C cell proliferative abnormalities ranging from C cell hyperplasia to invasive tumors
- Staining for calcitonin in medullary carcinoma of the thyroid produces a fine granular pattern in the cytoplasm
- Amyloid deposits within the tumor may also exhibit varying degrees of calcitonin activity.
Compare Similar Items
Show Difference
Antigen: Calcitonin
Classification: Polyclonal
Conjugate: Unconjugated
Gene: CALCA
Gene Alias: Alpha CGRP, Alpha type CGRP, Alpha-type CGRP, CA, Cal1, CAL6, CALC, CALC1, Calca, Calcitonin, calcitonin 1, Calcitonin carboxyl-terminal peptide, calcitonin gene related peptide 1, calcitonin gene related peptide I, calcitonin gene related peptide I precursor, Calcitonin gene-related peptide, calcitonin gene-related peptide 1, Calcitonin gene-related peptide I, calcitonin precursor, calcitonin related polypeptide alpha, calcitonin/calcitonin-related polypeptide, alpha, calcitonin, calcitonin gene-related peptide 1, calcitonin-like, calcitonin-related polypeptide alpha, CCALCI, CCP, Cgrp, CGRP1, CGRP-1, CGRPI, CGRP-I, CT, Ctn, katacalcin, katacalcin (KC), KC, PCT, PDN-21, prepro-alpha-calcitonin gene-related peptide, procalcitonin, RATCAL6
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 12310, 24241, 796
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form: Lyophilized
Applications: Immunohistochemistry (Paraffin)
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: P01256, P01257, P01258, P06881, P70160
Gene Symbols: CALCA
Immunogen: A synthetic peptide corresponding to a sequence of mouse Calcitonin (CGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAP).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: Smoothelin
Classification: Polyclonal
Conjugate: Unconjugated
Gene: SMTN
Gene Alias: FLJ35365, FLJ38597, smoothelin, smoothelin-B, smsmo, SMTN
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 29856, 6525
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form: Lyophilized
Applications: Immunocytochemistry, Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: P53814, Q921U8
Gene Symbols: SMTN
Immunogen: A synthetic peptide corresponding to a sequence of human Smoothelin (QELEREEEALASKRFRAERQDNKENWLHSQQREAEQR).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse
Product Type: Antibody
Isotype: IgG
Antigen: Thrombospondin 2
Classification: Polyclonal
Conjugate: Unconjugated
Gene: THBS2
Gene Alias: Thbs2, Thbs-2, thrombospondin 2, Thrombospondin2, thrombospondin-2, TSP2, TSP-2, TSP2thrombospondin-2
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 21826, 292406, 7058
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form: Lyophilized
Applications: Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: P35442, Q03350
Gene Symbols: THBS2
Immunogen: A synthetic peptide corresponding to a sequence of mouse Thrombospondin 2 (DHVKDTSFDLFSISNINRKTIGAKQFRGPD).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
