BCL6 Polyclonal Antibody, Invitrogen™
Manufacturer: Thermo Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | PIPA595591-Each-of-1 | In Stock | ₹ 45,218.46 |
PIPA595591 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 45,218.46
GST (18%): ₹ 8,139.323
Total Price: ₹ 53,357.783
Antigen
BCL6
Classification
Polyclonal
Conjugate
Unconjugated
Gene
BCL6
Gene Alias
B cell CLL/lymphoma 6, B cell leukemia/lymphoma 6, B-cell CLL/lymphoma 6, B-cell CLL/lymphoma 6 (zinc finger protein 51), B-cell leukemia/lymphoma 5, B-cell leukemia/lymphoma 6, B-cell lymphoma 5 protein, B-cell lymphoma 5 protein (BCL5), B-cell lymphoma 6 protein, B-cell lymphoma 6 protein homolog, B-cell lymphoma 6 protein transcript, BCL5, BCL-5, Bcl6, Bcl-6, BCL6 transcription repressor, BCL6A, cys his2 zinc finger transcription factor, cys-his2 zinc finger transcription factor, LAZ3, LAZ-3 protein, Lymphoma Associated Zinc Finger Gene On Chromosome 3 (LAZ3), lymphoma-associated zinc finger gene on chromosome 3, protein LAZ-3, ZBTB27, zinc finger and BTB domain-containing protein 27, Zinc finger and BTB domain-containing protein 27 (ZBTB27), Zinc finger protein 51, Zinc Finger Protein 51 (ZNF51), zinc finger transcription factor BCL6S, ZNF51
Host Species
Rabbit
Purification Method
Affinity chromatography
Regulatory Status
RUO
Gene ID (Entrez)
12053, 303836, 604
Content And Storage
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form
Lyophilized
Applications
Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot
Concentration
500 μg/mL
Formulation
PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.
P41182, P41183
Gene Symbols
BCL6
Immunogen
A synthetic peptide corresponding to a sequence of human BCL6 (ASPADSCIQFTRHASDVLLNLNRLRSRDILTD).
Quantity
100 μg
Primary or Secondary
Primary
Target Species
Human, Mouse, Rat
Product Type
Antibody
Isotype
IgG
Related Products
Description
- Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL
- Bcl-6 proto-oncogene product (a Kruppel-type zinc-finger protein) is mainly expressed in normal germinal center B cells and related lymphomas
- Bcl-6 is involved in chromosome rearrangements at 3q27 in non-Hodgkin's lymphomas and Bcl-6 rearrangements have been detected in 33%-45% of diffuse large B cell lymphomas
- Bcl-6 has been detected immunohistochemically in follicular lymphomas, diffuse large B cell lymphomas, Burkitt's lymphomas and in nodular, lymphocyte predominant Hodgkin's disease.
Compare Similar Items
Show Difference
Antigen: BCL6
Classification: Polyclonal
Conjugate: Unconjugated
Gene: BCL6
Gene Alias: B cell CLL/lymphoma 6, B cell leukemia/lymphoma 6, B-cell CLL/lymphoma 6, B-cell CLL/lymphoma 6 (zinc finger protein 51), B-cell leukemia/lymphoma 5, B-cell leukemia/lymphoma 6, B-cell lymphoma 5 protein, B-cell lymphoma 5 protein (BCL5), B-cell lymphoma 6 protein, B-cell lymphoma 6 protein homolog, B-cell lymphoma 6 protein transcript, BCL5, BCL-5, Bcl6, Bcl-6, BCL6 transcription repressor, BCL6A, cys his2 zinc finger transcription factor, cys-his2 zinc finger transcription factor, LAZ3, LAZ-3 protein, Lymphoma Associated Zinc Finger Gene On Chromosome 3 (LAZ3), lymphoma-associated zinc finger gene on chromosome 3, protein LAZ-3, ZBTB27, zinc finger and BTB domain-containing protein 27, Zinc finger and BTB domain-containing protein 27 (ZBTB27), Zinc finger protein 51, Zinc Finger Protein 51 (ZNF51), zinc finger transcription factor BCL6S, ZNF51
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 12053, 303836, 604
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form: Lyophilized
Applications: Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: P41182, P41183
Gene Symbols: BCL6
Immunogen: A synthetic peptide corresponding to a sequence of human BCL6 (ASPADSCIQFTRHASDVLLNLNRLRSRDILTD).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human, Mouse, Rat
Product Type: Antibody
Isotype: IgG
Antigen: CD84
Classification: Polyclonal
Conjugate: Unconjugated
Gene: CD84
Gene Alias: A130013D22Rik, CD84, CD84 antigen, CD84 antigen (leukocyte antigen), CD84 molecule, CDw84, cell surface antigen MAX.3, DKFZp781E2378, hCD84, Hly9-beta, leucocyte differentiation antigen CD84, leukocyte antigen CD84, leukocyte differentiation antigen CD84, LY9B, mCD84, RGD1564553, Signaling lymphocytic activation molecule 5, SLAM family member 5, SLAMF5
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 8832
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form: Lyophilized
Applications: ELISA, Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Frozen)
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: Q9UIB8
Gene Symbols: CD84
Immunogen: E.coli-derived human CD84 recombinant protein (Position: K22-G225).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Product Type: Antibody
Isotype: IgG
Antigen: CLEC9A
Classification: Polyclonal
Conjugate: Unconjugated
Gene: CLEC9A
Gene Alias: 9830005G06Rik, CD370, Clec9a, C-type lectin domain family 9 member A, C-type lectin domain family 9, member A, Dendritic cell natural killer lectin group receptor 1, DNGR1, DNGR-1, HEEE9341, RGD1562513, UNQ9341, UNQ9341/PRO34046
Host Species: Rabbit
Purification Method: Affinity chromatography
Regulatory Status: RUO
Gene ID (Entrez): 283420
Content And Storage: Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Form: Lyophilized
Applications: Flow Cytometry, Immunocytochemistry, Immunohistochemistry (Frozen)
Concentration: 500 μg/mL
Formulation: PBS with 4MG trehalose and 0.05MG sodium azide
Gene Accession No.: Q6UXN8
Gene Symbols: CLEC9A
Immunogen: A synthetic peptide corresponding to a sequence of human CLEC9A (EIWSIWHTSQENCLKEGSTLLQIESKEEMDFITGSLRKIK).
Quantity: 100 μg
Primary or Secondary: Primary
Target Species: Human
Product Type: Antibody
Isotype: IgG
