Novus Biologicals™ EIF4A3 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP185268PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP185268PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
9775
Purification Method
Chromatography
Concentration
0.5mg/mL
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
ATP-dependent RNA helicase DDX48, ATP-dependent RNA helicase eIF4A-3, DDX48, DEAD (Asp-Glu-Ala-Asp) box polypeptide 48, DEAD box protein 48, DKFZp686O16189, EC 3.6.1, EC 3.6.4.13, eIF4AIII, eIF-4A-III, eIF4A-III, eukaryotic initiation factor 4A-III, Eukaryotic initiation factor 4A-like NUK-34, eukaryotic translation initiation factor 4A, Eukaryotic translation initiation factor 4A isoform 3, eukaryotic translation initiation factor 4A3, hNMP 265, KIAA0111eukaryotic translation initiation factor 4A, isoform 3, MGC10862, NMP 265, NMP265, Nuclear matrix protein 265, NUK34
Label Type
Unlabeled
Product Type
EIF4A3
Regulatory Status
RUO
Source
E.Coli
Immunogen
MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIK
Species
Human
Purity
>80%
Content And Storage
Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
EIF4A3
Molecular Weight (g/mol)
26kDa
Quantity
0.1mL
Research Category
Signal Transduction
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85268. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EIF4A3
- The EIF4A3 Recombinant Protein Antigen is derived from E
- coli
- The EIF4A3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
SAFETY INFORMATION
- ShelfLife : 365
Compare Similar Items
Show Difference
Gene ID (Entrez): 9775
Purification Method: Chromatography
Concentration: 0.5mg/mL
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: ATP-dependent RNA helicase DDX48, ATP-dependent RNA helicase eIF4A-3, DDX48, DEAD (Asp-Glu-Ala-Asp) box polypeptide 48, DEAD box protein 48, DKFZp686O16189, EC 3.6.1, EC 3.6.4.13, eIF4AIII, eIF-4A-III, eIF4A-III, eukaryotic initiation factor 4A-III, Eukaryotic initiation factor 4A-like NUK-34, eukaryotic translation initiation factor 4A, Eukaryotic translation initiation factor 4A isoform 3, eukaryotic translation initiation factor 4A3, hNMP 265, KIAA0111eukaryotic translation initiation factor 4A, isoform 3, MGC10862, NMP 265, NMP265, Nuclear matrix protein 265, NUK34
Label Type: Unlabeled
Product Type: EIF4A3
Regulatory Status: RUO
Source: E.Coli
Immunogen: MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIK
Species: Human
Purity: >80%
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: EIF4A3
Molecular Weight (g/mol): 26kDa
Quantity: 0.1mL
Research Category: Signal Transduction
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85268. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 9785
Purification Method: Chromatography
Concentration: 0.5mg/mL
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Label Type: Unlabeled
Product Type: DHX38
Regulatory Status: RUO
Source: E.Coli
Immunogen: MDEGYDEFHNPLAYSSEDYVRRREQHLHKQKQKRISAQRRQINEDNERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLVPPFLDGRIVFTKQPE
Species: Human
Purity: >80%
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: DHX38
Molecular Weight (g/mol): 30kDa
Quantity: 0.1mL
Research Category: __
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85269. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 54505
Purification Method: Affinity Purified
Concentration: __
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: ATP-dependent RNA helicase DHX29, DDX29, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 29, DEAH (Asp-Glu-Ala-His) box polypeptide 29, DEAH box protein 29, EC 3.6.1, EC 3.6.4.13, FLJ21492, Nucleic acid helicase DDXx
Label Type: __
Product Type: __
Regulatory Status: RUO
Source: __
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LQAFSFKTKDIEDAMTNTLLYGGDLHSALDWLCLNLSDDALPEGFSQEFEEQQPKSRPKFQSPQIQATISPPLQPKTK
Species: __
Purity: __
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Molecular Weight (g/mol): __
Quantity: 0.1 mL
Research Category: __
Specific Reactivity: __