Manufacturer: Novus Biologicals™
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP185959PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP185959PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
2207
Chromatography
0.5mg/mL
PBS and 1M Urea, pH 7.4.
FCER1G
22kDa
0.1mL
E.Coli
KIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Human
>80%
Store at -20°C. Avoid freeze-thaw cycles.
Blocking/Neutralizing, Control
Unlabeled
FCER1G
RUO
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85959. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml