NBP189111PE

Novus Biologicals™ GPT Recombinant Protein Antigen

Manufacturer: Novus Biologicals™

Select a Size

Pack Size SKU Availability Price
Each of 1 NBP189111PE-Each-of-1 In Stock ₹ 30,159.90

NBP189111PE - Each of 1

₹ 30,159.90

In Stock

Quantity

1

Base Price: ₹ 30,159.90

GST (18%): ₹ 5,428.782

Total Price: ₹ 35,588.682

Gene ID (Entrez)

2875

Purification Method

Chromatography

Concentration

0.5mg/mL

Formulation

PBS and 1M Urea, pH 7.4.

Gene Alias

AAT1alanine aminotransferase 1, ALT1, ALT1EC 2.6.1.2, Glutamate pyruvate transaminase 1, glutamic-alanine transaminase 1, Glutamic--alanine transaminase 1, glutamic-pyruvate transaminase (alanine aminotransferase), Glutamic--pyruvic transaminase 1, GPT1GPT 1

Label Type

Unlabeled

Product Type

GPT

Regulatory Status

RUO

Source

E.Coli

Immunogen

MASSTGDRSQAVRNGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFT

Species

Human

Purity

>80%

Content And Storage

Store at -20°C. Avoid freeze-thaw cycles.

For Use With (Application)

Blocking/Neutralizing, Control

Gene Symbol

GPT

Molecular Weight (g/mol)

24kDa

Quantity

0.1mL

Research Category

metabolism

Specific Reactivity

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89111. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

Related Products

Img

Novus Biologicals™

NBP189110PE

--

Img

Novus Biologicals™

NBP189760PE

--

Img

Novus Biologicals™

NBP189815PE

--

Img

Novus Biologicals™

NBP238253PE

--

Img

Novus Biologicals™

NBP182748PE

--

Img

Novus Biologicals™

NBP186133PE

--

Img

Novus Biologicals™

NBP189814PE

--

Img

Novus Biologicals™

NBP189490PE

--

Description

  • A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPT
  • The GPT Recombinant Protein Antigen is derived from E
  • coli
  • The GPT Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

SAFETY INFORMATION

  • ShelfLife : 365

Compare Similar Items

Show Difference

Img

Novus Biologicals™

NBP189111PE

--


Gene ID (Entrez):
2875

Purification Method:
Chromatography

Concentration:
0.5mg/mL

Formulation:
PBS and 1M Urea, pH 7.4.

Gene Alias:
AAT1alanine aminotransferase 1, ALT1, ALT1EC 2.6.1.2, Glutamate pyruvate transaminase 1, glutamic-alanine transaminase 1, Glutamic--alanine transaminase 1, glutamic-pyruvate transaminase (alanine aminotransferase), Glutamic--pyruvic transaminase 1, GPT1GPT 1

Label Type:
Unlabeled

Product Type:
GPT

Regulatory Status:
RUO

Source:
E.Coli

Immunogen:
MASSTGDRSQAVRNGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFT

Species:
Human

Purity:
>80%

Content And Storage:
Store at -20°C. Avoid freeze-thaw cycles.

For Use With (Application):
Blocking/Neutralizing, Control

Gene Symbol:
GPT

Molecular Weight (g/mol):
24kDa

Quantity:
0.1mL

Research Category:
metabolism

Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89111. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

Img

Novus Biologicals™

NBP189112PE

--


Gene ID (Entrez):
9217

Purification Method:
Chromatography

Concentration:
0.5mg/mL

Formulation:
PBS and 1M Urea, pH 7.4.

Gene Alias:
__

Label Type:
Unlabeled

Product Type:
VAP-B

Regulatory Status:
RUO

Source:
E.Coli

Immunogen:
VWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGK

Species:
Human

Purity:
>80%

Content And Storage:
Store at -20°C. Avoid freeze-thaw cycles.

For Use With (Application):
Blocking/Neutralizing, Control

Gene Symbol:
VAPB

Molecular Weight (g/mol):
30kDa

Quantity:
0.1mL

Research Category:
Neuroscience

Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89112. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

Img

Novus Biologicals™

NBP189113PE

--


Gene ID (Entrez):
2521

Purification Method:
Chromatography

Concentration:
0.5mg/mL

Formulation:
PBS and 1M Urea, pH 7.4.

Gene Alias:
__

Label Type:
Unlabeled

Product Type:
FUS

Regulatory Status:
RUO

Source:
E.Coli

Immunogen:
SSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDR

Species:
Human

Purity:
>80%

Content And Storage:
Store at -20°C. Avoid freeze-thaw cycles.

For Use With (Application):
Blocking/Neutralizing, Control

Gene Symbol:
FUS

Molecular Weight (g/mol):
30kDa

Quantity:
0.1mL

Research Category:
__

Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89113. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

Img

Fischer Scientific

NBP189114

--


Gene ID (Entrez):
117583

Purification Method:
Affinity Purified

Concentration:
__

Formulation:
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide

Gene Alias:
ALS2CR19, amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 19, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 19 protein, MGC16131, par-3 partitioning defective 3 homolog B (C. elegans), PAR3B, PAR3beta, PAR3-beta, PAR3L, PAR3-L protein, Par3Lb, PAR3LC, partitioning defective 3 homolog B, Partitioning defective 3-like protein, partitioning-defective 3-beta

Label Type:
__

Product Type:
__

Regulatory Status:
RUO

Source:
__

Immunogen:
This antibody was developed against Recombinant Protein corresponding to amino acids:ARREGFPLYEDDEGRARPSEYDLLWVPGRGPDGNAHNLRFEGMERQYASLPRGGPADPVDYLPAAPRGLYKERELPYYPGAHPMHPPKGSYPRPTELRVADLRYPQ

Species:
__

Purity:
__

Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Use With (Application):
__

Gene Symbol:
__

Molecular Weight (g/mol):
__

Quantity:
0.1 mL

Research Category:
__

Specific Reactivity:
__