NBP191886PE

Novus Biologicals™ FAM36A Recombinant Protein Antigen

Manufacturer: Novus Biologicals™

Select a Size

Pack Size SKU Availability Price
Each of 1 NBP191886PE-Each-of-1 In Stock ₹ 30,159.90

NBP191886PE - Each of 1

₹ 30,159.90

In Stock

Quantity

1

Base Price: ₹ 30,159.90

GST (18%): ₹ 5,428.782

Total Price: ₹ 35,588.682

Gene ID (Entrez)

116228

Purification Method

Chromatography

Concentration

0.5mg/mL

Formulation

PBS and 1M Urea, pH 7.4.

Gene Symbol

COX20

Molecular Weight (g/mol)

22kDa

Quantity

0.1mL

Source

E.Coli

Immunogen

YNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN

Species

Human

Purity

>80%

Content And Storage

Store at -20°C. Avoid freeze-thaw cycles.

For Use With (Application)

Blocking/Neutralizing, Control

Label Type

Unlabeled

Product Type

FAM36A

Regulatory Status

RUO

Specific Reactivity

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91886. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

Related Products

Img

Novus Biologicals™

NBP191970PE

--

Img

Novus Biologicals™

NBP192196PE

--

Img

Novus Biologicals™

NBP192100PE

--

Img

Novus Biologicals™

NBP192000PE

--

Img

Novus Biologicals™

NBP192181PE

--

Img

Novus Biologicals™

NBP192225PE

--

Img

Novus Biologicals™

NBP192522PE

--

Img

Novus Biologicals™

NBP191962PE

--

Description

  • A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COX20
  • The FAM36A Recombinant Protein Antigen is derived from E
  • coli
  • The FAM36A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

SAFETY INFORMATION

  • ShelfLife : 365

Compare Similar Items

Show Difference

Img

Novus Biologicals™

NBP191886PE

--


Gene ID (Entrez):
116228

Purification Method:
Chromatography

Concentration:
0.5mg/mL

Formulation:
PBS and 1M Urea, pH 7.4.

Gene Symbol:
COX20

Molecular Weight (g/mol):
22kDa

Quantity:
0.1mL

Source:
E.Coli

Immunogen:
YNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN

Species:
Human

Purity:
>80%

Content And Storage:
Store at -20°C. Avoid freeze-thaw cycles.

For Use With (Application):
Blocking/Neutralizing, Control

Label Type:
Unlabeled

Product Type:
FAM36A

Regulatory Status:
RUO

Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91886. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

Img

Novus Biologicals

NBP191887

--


Gene ID (Entrez):
6624

Purification Method:
Affinity Purified

Concentration:
__

Formulation:
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide

Gene Symbol:
__

Molecular Weight (g/mol):
__

Quantity:
0.1 mL

Source:
__

Immunogen:
This antibody was developed against Recombinant Protein corresponding to amino acids:GKDELFALEQSCAQVVLQAANERNVSTRQGMDLSANQDEETDQETFQLEIDRDTKKCAFRTHTGKYWTLTATGGVQSTASSKNASCYFDIEWRDRRITLRASNGKFVTSKKNGQ

Species:
__

Purity:
__

Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Use With (Application):
__

Label Type:
__

Product Type:
__

Regulatory Status:
RUO

Specific Reactivity:
__

Img

Novus Biologicals™

NBP191887PE

--


Gene ID (Entrez):
6624

Purification Method:
Chromatography

Concentration:
0.5mg/mL

Formulation:
PBS and 1M Urea, pH 7.4.

Gene Symbol:
FSCN1

Molecular Weight (g/mol):
30kDa

Quantity:
0.1mL

Source:
E.Coli

Immunogen:
GKDELFALEQSCAQVVLQAANERNVSTRQGMDLSANQDEETDQETFQLEIDRDTKKCAFRTHTGKYWTLTATGGVQSTASSKNASCYFDIEWRDRRITLRASNGKFVTSKKNGQ

Species:
Human

Purity:
>80%

Content And Storage:
Store at -20°C. Avoid freeze-thaw cycles.

For Use With (Application):
Blocking/Neutralizing, Control

Label Type:
Unlabeled

Product Type:
Fascin

Regulatory Status:
RUO

Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91887. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

Img

Novus Biologicals

NBP191888

--


Gene ID (Entrez):
60493

Purification Method:
Affinity Purified

Concentration:
__

Formulation:
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide

Gene Symbol:
__

Molecular Weight (g/mol):
__

Quantity:
0.1 mL

Source:
__

Immunogen:
This antibody was developed against Recombinant Protein corresponding to amino acids:MELENKAAVPLGGFLCNVADKSGAMEMAGLCPAACMQTPRMKLAVQFTNRNQYCYGSRDLLGLHNMKRRQLARLGYRVVELSYWEWLPLLKRTRLEKLAFLHEKVFTSA

Species:
__

Purity:
__

Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Use With (Application):
__

Label Type:
__

Product Type:
__

Regulatory Status:
RUO

Specific Reactivity:
__