NBP238780PE

Novus Biologicals™ PSMD7 Recombinant Protein Antigen

Manufacturer: Novus Biologicals™

Select a Size

Pack Size SKU Availability Price
Each of 1 NBP238780PE-Each-of-1 In Stock ₹ 30,159.90

NBP238780PE - Each of 1

₹ 30,159.90

In Stock

Quantity

1

Base Price: ₹ 30,159.90

GST (18%): ₹ 5,428.782

Total Price: ₹ 35,588.682

Gene ID (Entrez)

5713

Purification Method

Chromatography

Concentration

0.5mg/mL

Formulation

PBS and 1M Urea, pH 7.4.

Gene Symbol

PSMD7

Molecular Weight (g/mol)

25kDa

Quantity

0.1mL

Source

E.Coli

Immunogen

IVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSK

Species

Human

Purity

>80%

Content And Storage

Store at -20°C. Avoid freeze-thaw cycles.

For Use With (Application)

Blocking/Neutralizing, Control

Label Type

Unlabeled

Product Type

PSMD7

Regulatory Status

RUO

Specific Reactivity

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38780. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

Description

  • A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PSMD7
  • The PSMD7 Recombinant Protein Antigen is derived from E
  • coli
  • The PSMD7 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

SAFETY INFORMATION

  • ShelfLife : 365

Compare Similar Items

Show Difference

Img

Novus Biologicals™

NBP238780PE

--


Gene ID (Entrez):
5713

Purification Method:
Chromatography

Concentration:
0.5mg/mL

Formulation:
PBS and 1M Urea, pH 7.4.

Gene Symbol:
PSMD7

Molecular Weight (g/mol):
25kDa

Quantity:
0.1mL

Source:
E.Coli

Immunogen:
IVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSK

Species:
Human

Purity:
>80%

Content And Storage:
Store at -20°C. Avoid freeze-thaw cycles.

For Use With (Application):
Blocking/Neutralizing, Control

Label Type:
Unlabeled

Product Type:
PSMD7

Regulatory Status:
RUO

Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38780. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

Img

Fischer Scientific

NBP238781

--


Gene ID (Entrez):
8798

Purification Method:
Affinity Purified

Concentration:
__

Formulation:
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide

Gene Symbol:
__

Molecular Weight (g/mol):
__

Quantity:
0.1 mL

Source:
__

Immunogen:
This antibody was developed against a recombinant protein corresponding to amino acids: GDQQDCLQHGADTVQLPQLVDAPKKSEAAVGAEVSMTSPGQSKNFSLKNTNV

Species:
__

Purity:
__

Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Use With (Application):
__

Label Type:
__

Product Type:
__

Regulatory Status:
RUO

Specific Reactivity:
__

Img

Novus Biologicals™

NBP238782PE

--


Gene ID (Entrez):
90459

Purification Method:
Chromatography

Concentration:
0.5mg/mL

Formulation:
PBS and 1M Urea, pH 7.4.

Gene Symbol:
ERI1

Molecular Weight (g/mol):
25kDa

Quantity:
0.1mL

Source:
E.Coli

Immunogen:
ELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESNFADSYYDYICIIDFEATCEE

Species:
Human

Purity:
>80%

Content And Storage:
Store at -20°C. Avoid freeze-thaw cycles.

For Use With (Application):
Blocking/Neutralizing, Control

Label Type:
Unlabeled

Product Type:
HEXO

Regulatory Status:
RUO

Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38782. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

Img

Fischer Scientific

NBP238784

--


Gene ID (Entrez):
5274

Purification Method:
Affinity Purified

Concentration:
__

Formulation:
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide

Gene Symbol:
__

Molecular Weight (g/mol):
__

Quantity:
0.1 mL

Source:
__

Immunogen:
This antibody was developed against a recombinant protein corresponding to amino acids: TGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGN

Species:
__

Purity:
__

Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Use With (Application):
__

Label Type:
__

Product Type:
__

Regulatory Status:
RUO

Specific Reactivity:
__