Novus Biologicals™ ATP6V0A4 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP239030PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP239030PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
50617
Purification Method
Chromatography
Concentration
0.5mg/mL
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
A4, ATP6N2, ATP6V0, ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalytic accessory protein 1B, ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalytic accessory protein 2 (38kD), ATPase, H+ transporting, lysosomal V0 subunit a4, MGC130016, MGC130017, noncatalytic accessory protein 1B, RDRTA2, RTA1C, RTADR, STV1, vacuolar proton pump 116 kDa accessory subunit, vacuolar proton pump, subunit 2, vacuolar proton translocating ATPase 116 kDa subunit a kidney isoform, V-ATPase 116 kDa, VPH1, VPP2, V-type proton ATPase 116 kDa subunit a, V-type proton ATPase 116 kDa subunit a isoform 4
Label Type
Unlabeled
Product Type
ATP6V0A4
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-39030. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Species
Human
Purity
>80%
Content And Storage
Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
ATP6V0A4
Molecular Weight (g/mol)
25kDa
Quantity
0.1mL
Source
E.Coli
Immunogen
NQNQQALKQSFLELTELKYLLKKTQDFFETETNLADDFFTEDTSGLLELKAVPAYMTGKL
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP6V0A4
- The ATP6V0A4 Recombinant Protein Antigen is derived from E
- coli
- The ATP6V0A4 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
SAFETY INFORMATION
- ShelfLife : 365
Compare Similar Items
Show Difference
Gene ID (Entrez): 50617
Purification Method: Chromatography
Concentration: 0.5mg/mL
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: A4, ATP6N2, ATP6V0, ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalytic accessory protein 1B, ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalytic accessory protein 2 (38kD), ATPase, H+ transporting, lysosomal V0 subunit a4, MGC130016, MGC130017, noncatalytic accessory protein 1B, RDRTA2, RTA1C, RTADR, STV1, vacuolar proton pump 116 kDa accessory subunit, vacuolar proton pump, subunit 2, vacuolar proton translocating ATPase 116 kDa subunit a kidney isoform, V-ATPase 116 kDa, VPH1, VPP2, V-type proton ATPase 116 kDa subunit a, V-type proton ATPase 116 kDa subunit a isoform 4
Label Type: Unlabeled
Product Type: ATP6V0A4
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-39030. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Species: Human
Purity: >80%
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ATP6V0A4
Molecular Weight (g/mol): 25kDa
Quantity: 0.1mL
Source: E.Coli
Immunogen: NQNQQALKQSFLELTELKYLLKKTQDFFETETNLADDFFTEDTSGLLELKAVPAYMTGKL
Gene ID (Entrez): 101
Purification Method: Affinity Purified
Concentration: __
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: a disintegrin and metalloproteinase domain 8, ADAM 8, ADAM metallopeptidase domain 8, CD156a antigen, CD156human leukocyte differentiation antigen, Cell surface antigen MS2, EC 3.4.24, EC 3.4.24.-, MGC134985, MS2disintegrin and metalloproteinase domain-containing protein 8
Label Type: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Species: __
Purity: __
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Molecular Weight (g/mol): __
Quantity: 0.1 mL
Source: __
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QYEVVLPWRLPGPRVRRALPSHLGLHPERVSYVLGATGHNFTLHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHV
Gene ID (Entrez): 8908
Purification Method: Affinity Purified
Concentration: __
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: glycogenin 2, glycogenin-2, GN-2GN2EC 2.4.1.186
Label Type: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Species: __
Purity: __
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Molecular Weight (g/mol): __
Quantity: 0.1 mL
Source: __
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MIACPETETPAVITCDPLSQPSPQPADFTETETILQPANKVESVSSEETFEPSQELPAEALRDPSLQDALEVDLAVSVSQISIEEKVKELSPE