Novus Biologicals™ TIA1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP254962PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP254962PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
7072
Common Name
TIA1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
cytotoxic granule-associated RNA-binding protein, nucleolysin TIA-1 isoform p40, p40-TIA-1, p40-TIA-1 (containing p15-TIA-1), RNA-binding protein TIA-1, T-cell-restricted intracellular antigen-1, TIA-1, TIA1 cytotoxic granule-associated RNA binding protei
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
TIA1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52136. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TIA1
- Source: E.coli Amino Acid Sequence: NQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRV The TIA1 Recombinant Protein Antigen is derived from E
- coli
- The TIA1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 7072
Common Name: TIA1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: cytotoxic granule-associated RNA-binding protein, nucleolysin TIA-1 isoform p40, p40-TIA-1, p40-TIA-1 (containing p15-TIA-1), RNA-binding protein TIA-1, T-cell-restricted intracellular antigen-1, TIA-1, TIA1 cytotoxic granule-associated RNA binding protei
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: TIA1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52136. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 1746
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: distal-less homeo box 2, distal-less homeobox 2, homeobox protein DLX-2, TES1, TES-1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez): 1746
Common Name: DLX2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: distal-less homeo box 2, distal-less homeobox 2, homeobox protein DLX-2, TES1, TES-1
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: −20°C, avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: DLX2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52137. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
