NBP254970PE
Novus Biologicals™ PKC epsilon Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP254970PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP254970PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
5581
Common Name
PKC epsilon Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
EC 2.7.11, EC 2.7.11.13, MGC125656, nPKC-epsilon, PKCEMGC125657, protein kinase C epsilon type, protein kinase C, epsilon
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
PRKCE
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51904. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PKC epsilon
- Source: E.coli Amino Acid Sequence: PSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKR The PKC epsilon Recombinant Protein Antigen is derived from E
- coli
- The PKC epsilon Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 5581
Common Name: PKC epsilon Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: EC 2.7.11, EC 2.7.11.13, MGC125656, nPKC-epsilon, PKCEMGC125657, protein kinase C epsilon type, protein kinase C, epsilon
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PRKCE
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51904. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
5581
Common Name:
PKC epsilon Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
EC 2.7.11, EC 2.7.11.13, MGC125656, nPKC-epsilon, PKCEMGC125657, protein kinase C epsilon type, protein kinase C, epsilon
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PRKCE
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51904. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 4656
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: BHLHC3, bHLHc3Myogenic factor-4; myogenin, Class C basic helix-loop-helix protein 3, myf-4, MYF4myogenin, Myogenic factor 4, MYOGENIN, myogenin (myogenic factor 4)
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
4656
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
BHLHC3, bHLHc3Myogenic factor-4; myogenin, Class C basic helix-loop-helix protein 3, myf-4, MYF4myogenin, Myogenic factor 4, MYOGENIN, myogenin (myogenic factor 4)
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 4656
Common Name: Myogenin Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: BHLHC3, bHLHc3Myogenic factor-4; myogenin, Class C basic helix-loop-helix protein 3, myf-4, MYF4myogenin, Myogenic factor 4, MYOGENIN, myogenin (myogenic factor 4)
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: MYOG
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51144. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
4656
Common Name:
Myogenin Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
BHLHC3, bHLHc3Myogenic factor-4; myogenin, Class C basic helix-loop-helix protein 3, myf-4, MYF4myogenin, Myogenic factor 4, MYOGENIN, myogenin (myogenic factor 4)
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
MYOG
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51144. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 84072
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Cancer/testis antigen 46, CT46DKFZP434A1315, HORMA domain containing 1, HORMA domain-containing protein 1, Newborn ovary HORMA protein, NOHMADKFZp434A1315
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
84072
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Cancer/testis antigen 46, CT46DKFZP434A1315, HORMA domain containing 1, HORMA domain-containing protein 1, Newborn ovary HORMA protein, NOHMADKFZp434A1315
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__