Manufacturer: Novus Biologicals™
Pack Size | SKU | Availability | Price |
---|---|---|---|
Each of 1 | NBP254988PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP254988PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Greater than 80% by SDS-PAGE and Coomassie blue staining
Store at -20°C. Avoid freeze-thaw cycles.
28 kDa
100 uL
E. coli
HADHA Recombinant Protein Antigen
Antibody Competition
Recombinant Protein Antigen
DEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHANSPNKK
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50314. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml