NBP254996PE
Novus Biologicals™ SOX13 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP254996PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP254996PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
9580
Common Name
SOX13 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
Islet cell antigen 12, MGC117216, Sox-13, SRY (sex determining region Y)-box 13ICA12islet cell 12, SRY-box 13, SRY-related HMG-box gene 13, transcription factor SOX-13, Type 1 diabetes autoantigen ICA12
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
SOX13
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50211. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SOX13
- Source: E.coli Amino Acid Sequence: DVLYPRAAGMPLAQPLVEHYVPRSLDPNMPVIVNTCSLREEGEGTDDRHSVADGEMYRYSEDEDSEGEEKSDGELVVLT The SOX13 Recombinant Protein Antigen is derived from E
- coli
- The SOX13 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 9580
Common Name: SOX13 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: Islet cell antigen 12, MGC117216, Sox-13, SRY (sex determining region Y)-box 13ICA12islet cell 12, SRY-box 13, SRY-related HMG-box gene 13, transcription factor SOX-13, Type 1 diabetes autoantigen ICA12
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SOX13
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50211. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
9580
Common Name:
SOX13 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
Islet cell antigen 12, MGC117216, Sox-13, SRY (sex determining region Y)-box 13ICA12islet cell 12, SRY-box 13, SRY-related HMG-box gene 13, transcription factor SOX-13, Type 1 diabetes autoantigen ICA12
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SOX13
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50211. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 150274
Common Name: HSCB Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: DnaJ homolog subfamily C member 20, DNAJC20DnaJ (Hsp40) homolog, subfamily C, member 20, Hsc20, HSC20dJ366L4.2, HscB iron-sulfur cluster co-chaperone homolog (E. coli), iron-sulfur cluster co-chaperone protein HscB, mitochondrial, Jac1, J-type co-chaperon
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: HSCB
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49889. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
150274
Common Name:
HSCB Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
DnaJ homolog subfamily C member 20, DNAJC20DnaJ (Hsp40) homolog, subfamily C, member 20, Hsc20, HSC20dJ366L4.2, HscB iron-sulfur cluster co-chaperone homolog (E. coli), iron-sulfur cluster co-chaperone protein HscB, mitochondrial, Jac1, J-type co-chaperon
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
HSCB
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49889. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 55131
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: FLJ10377, RNA binding motif protein 28, RNA-binding motif protein 28,2810480G15Rik, RNA-binding protein 28
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
55131
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
FLJ10377, RNA binding motif protein 28, RNA-binding motif protein 28,2810480G15Rik, RNA-binding protein 28
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 10053
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Adaptor protein complex AP-1 mu-2 subunit, Adaptor-related protein complex 1 mu-2 subunit, adaptor-related protein complex 1, mu 2 subunit, AP-1 complex subunit mu-2, AP1-mu2, AP-mu chain family member mu1B, Clathrin assembly protein complex 1 medium chain 2, clathrin coat assembly protein AP47 2, clathrin coat associated protein AP47 2, clathrin-associated adaptor medium chain mu2, golgi adaptor AP-1 47 kDa protein, Golgi adaptor HA1/AP1 adaptin mu-2 subunit, HA1 47 kDa subunit 2, HSMU1B, MU1B, MU-1B, mu1B-adaptin, mu2, Mu-adaptin 2
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
10053
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Adaptor protein complex AP-1 mu-2 subunit, Adaptor-related protein complex 1 mu-2 subunit, adaptor-related protein complex 1, mu 2 subunit, AP-1 complex subunit mu-2, AP1-mu2, AP-mu chain family member mu1B, Clathrin assembly protein complex 1 medium chain 2, clathrin coat assembly protein AP47 2, clathrin coat associated protein AP47 2, clathrin-associated adaptor medium chain mu2, golgi adaptor AP-1 47 kDa protein, Golgi adaptor HA1/AP1 adaptin mu-2 subunit, HA1 47 kDa subunit 2, HSMU1B, MU1B, MU-1B, mu1B-adaptin, mu2, Mu-adaptin 2
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__