NBP255082PE
Novus Biologicals™ Von Hippel Lindau Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255082PE-Each-of-1 | In Stock | ₹ 26,095.80 |
NBP255082PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 26,095.80
GST (18%): ₹ 4,697.244
Total Price: ₹ 30,793.044
Gene ID (Entrez)
7428
Common Name
Von Hippel Lindau Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
elongin binding protein, HRCA1, Protein G7, pVHL, RCA1, VHL1, von Hippel-Lindau disease tumor suppressor, von Hippel-Lindau syndrome, von Hippel-Lindau tumor suppressor
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
VHL
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51223. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Von Hippel Lindau
- Source: E.coli Amino Acid Sequence: RRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAG The Von Hippel Lindau Recombinant Protein Antigen is derived from E
- coli
- The Von Hippel Lindau Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 7428
Common Name: Von Hippel Lindau Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: elongin binding protein, HRCA1, Protein G7, pVHL, RCA1, VHL1, von Hippel-Lindau disease tumor suppressor, von Hippel-Lindau syndrome, von Hippel-Lindau tumor suppressor
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: VHL
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51223. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
7428
Common Name:
Von Hippel Lindau Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
elongin binding protein, HRCA1, Protein G7, pVHL, RCA1, VHL1, von Hippel-Lindau disease tumor suppressor, von Hippel-Lindau syndrome, von Hippel-Lindau tumor suppressor
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
VHL
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51223. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 83737
Common Name: ITCH/AIP4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: AIF4, AIP4dJ468O1.1 (atrophin 1 interacting protein 4 (AIP4)), atrophin-1 interacting protein 4, Atrophin-1-interacting protein 4, dJ468O1.1, EC 6.3.2, EC 6.3.2.-, Itch, itchy (mouse homolog) E3 ubiquitin protein ligase, itchy E3 ubiquitin protein ligase
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ITCH
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50139. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
83737
Common Name:
ITCH/AIP4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
AIF4, AIP4dJ468O1.1 (atrophin 1 interacting protein 4 (AIP4)), atrophin-1 interacting protein 4, Atrophin-1-interacting protein 4, dJ468O1.1, EC 6.3.2, EC 6.3.2.-, Itch, itchy (mouse homolog) E3 ubiquitin protein ligase, itchy E3 ubiquitin protein ligase
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ITCH
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50139. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 26524
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: EC 2.7.11, EC 2.7.11.1, FLJ13161, Kinase phosphorylated during mitosis protein, KPM, Large tumor suppressor homolog 2, LATS (large tumor suppressor, Drosophila) homolog 2, LATS, large tumor suppressor, homolog 2 (Drosophila), serine/threonine kinase KPM, Serine/threonine-protein kinase kpm, serine/threonine-protein kinase LATS2, Warts-like kinase
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
26524
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
EC 2.7.11, EC 2.7.11.1, FLJ13161, Kinase phosphorylated during mitosis protein, KPM, Large tumor suppressor homolog 2, LATS (large tumor suppressor, Drosophila) homolog 2, LATS, large tumor suppressor, homolog 2 (Drosophila), serine/threonine kinase KPM, Serine/threonine-protein kinase kpm, serine/threonine-protein kinase LATS2, Warts-like kinase
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 26524
Common Name: LATS2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: EC 2.7.11, EC 2.7.11.1, FLJ13161, Kinase phosphorylated during mitosis protein, KPM, Large tumor suppressor homolog 2, LATS (large tumor suppressor, Drosophila) homolog 2, LATS, large tumor suppressor, homolog 2 (Drosophila), serine/threonine kinase KPM,
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: LATS2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51602. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
26524
Common Name:
LATS2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
EC 2.7.11, EC 2.7.11.1, FLJ13161, Kinase phosphorylated during mitosis protein, KPM, Large tumor suppressor homolog 2, LATS (large tumor suppressor, Drosophila) homolog 2, LATS, large tumor suppressor, homolog 2 (Drosophila), serine/threonine kinase KPM,
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
LATS2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51602. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml