Novus Biologicals™ LRCH3 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255087PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255087PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
84859
Common Name
LRCH3 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
FLJ20994, FLJ43245, FLJ44976,2210409B11Rik, leucine-rich repeat and calponin homology domain-containing protein 3, leucine-rich repeats and calponin homology (CH) domain containing 3, MGC4126
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
LRCH3
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51097. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LRCH3
- Source: E.coli Amino Acid Sequence: NLCSPSDILQLNLSVKRTVETLLSLGAHSEESSFVCLSL The LRCH3 Recombinant Protein Antigen is derived from E
- coli
- The LRCH3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 84859
Common Name: LRCH3 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: FLJ20994, FLJ43245, FLJ44976,2210409B11Rik, leucine-rich repeat and calponin homology domain-containing protein 3, leucine-rich repeats and calponin homology (CH) domain containing 3, MGC4126
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: LRCH3
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51097. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 10733
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: EC 2.7.11.21, PLK-4, polo-like kinase 4 (Drosophila), polo-like kinase 4SAKSTK18serine/threonine kinase 18, Sak, serine/threonine protein kinase SAK, Serine/threonine-protein kinase 18, serine/threonine-protein kinase PLK4, Serine/threonine-protein kinase Sak, Snk akin kinase
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez): 5886
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: hHR23A, HR23A
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
