NBP255151PE
Novus Biologicals™ Troponin C (cardiac) Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255151PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255151PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
7134
Common Name
Troponin C (cardiac) Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
cardiac troponin C, CMD1Z, CMH13, slow twitch skeletal/cardiac muscle troponin C, TNC, TN-C, TNNC, troponin C type 1 (slow), troponin C, slow, troponin C, slow skeletal and cardiac muscles, troponin C1, slow
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
TNNC1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51454. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Troponin C (cardiac)
- Source: E.coli Amino Acid Sequence: MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVM The Troponin C (cardiac) Recombinant Protein Antigen is derived from E
- coli
- The Troponin C (cardiac) Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 7134
Common Name: Troponin C (cardiac) Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: cardiac troponin C, CMD1Z, CMH13, slow twitch skeletal/cardiac muscle troponin C, TNC, TN-C, TNNC, troponin C type 1 (slow), troponin C, slow, troponin C, slow skeletal and cardiac muscles, troponin C1, slow
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: TNNC1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51454. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
7134
Common Name:
Troponin C (cardiac) Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
cardiac troponin C, CMD1Z, CMH13, slow twitch skeletal/cardiac muscle troponin C, TNC, TN-C, TNNC, troponin C type 1 (slow), troponin C, slow, troponin C, slow skeletal and cardiac muscles, troponin C1, slow
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
TNNC1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51454. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 10043
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: ADP-ribosylation factor-binding protein GGA3, golgi associated, gamma adaptin ear containing, ARF binding protein 3, golgi-associated, gamma adaptin ear containing, ARF binding protein 3, KIAA0154Golgi-localized, gamma ear-containing, ARF-binding protein 3
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
10043
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
ADP-ribosylation factor-binding protein GGA3, golgi associated, gamma adaptin ear containing, ARF binding protein 3, golgi-associated, gamma adaptin ear containing, ARF binding protein 3, KIAA0154Golgi-localized, gamma ear-containing, ARF-binding protein 3
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 9355
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: hLhx2, Homeobox protein LH-2, LH-2, LH2MGC138390, LIM homeobox 2, LIM homeobox protein 2, LIM HOX gene 2, LIM/homeobox protein Lhx2
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
9355
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
hLhx2, Homeobox protein LH-2, LH-2, LH2MGC138390, LIM homeobox 2, LIM homeobox protein 2, LIM HOX gene 2, LIM/homeobox protein Lhx2
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 9355
Common Name: LHX2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: hLhx2, Homeobox protein LH-2, LH-2, LH2MGC138390, LIM homeobox 2, LIM homeobox protein 2, LIM HOX gene 2, LIM/homeobox protein Lhx2
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: LHX2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51021. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
9355
Common Name:
LHX2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
hLhx2, Homeobox protein LH-2, LH-2, LH2MGC138390, LIM homeobox 2, LIM homeobox protein 2, LIM HOX gene 2, LIM/homeobox protein Lhx2
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
LHX2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51021. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml