NBP255213PE
Novus Biologicals™ RUNX1/CBFA2 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255213PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255213PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
861
Common Name
RUNX1/CBFA2 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
Acute myeloid leukemia 1 protein, AML1acute myeloid leukemia 1, AML1-EVI-1, CBFA2acute myeloid leukemia 1 protein (oncogene AML-1), core-binding factor, alphasubunit10AMLCR1, Core-binding factor subunit alpha-2, EVI-1, PEBP2A2, runt domain, alpha subunit
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
RUNX1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51313. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RUNX1/CBFA2
- Source: E.coli Amino Acid Sequence: LDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN The RUNX1/CBFA2 Recombinant Protein Antigen is derived from E
- coli
- The RUNX1/CBFA2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 861
Common Name: RUNX1/CBFA2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: Acute myeloid leukemia 1 protein, AML1acute myeloid leukemia 1, AML1-EVI-1, CBFA2acute myeloid leukemia 1 protein (oncogene AML-1), core-binding factor, alphasubunit10AMLCR1, Core-binding factor subunit alpha-2, EVI-1, PEBP2A2, runt domain, alpha subunit
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: RUNX1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51313. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
861
Common Name:
RUNX1/CBFA2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
Acute myeloid leukemia 1 protein, AML1acute myeloid leukemia 1, AML1-EVI-1, CBFA2acute myeloid leukemia 1 protein (oncogene AML-1), core-binding factor, alphasubunit10AMLCR1, Core-binding factor subunit alpha-2, EVI-1, PEBP2A2, runt domain, alpha subunit
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
RUNX1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51313. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 5551
Common Name: Perforin Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: Cytolysin, FLH2, HPLH2, HPLH2lymphocyte pore forming protein, Lymphocyte pore-forming protein, MGC65093, P1PFN1, perforin 1 (pore forming protein), perforin-1, PFPcytolysin
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PRF1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: Human
Gene ID (Entrez):
5551
Common Name:
Perforin Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
Cytolysin, FLH2, HPLH2, HPLH2lymphocyte pore forming protein, Lymphocyte pore-forming protein, MGC65093, P1PFN1, perforin 1 (pore forming protein), perforin-1, PFPcytolysin
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PRF1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
Human
Gene ID (Entrez): 55526
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: dehydrogenase E1 and transketolase domain containing 1, Dehydrogenase E1 and transketolase domain-containing protein 1, DKFZp762M115, EC 1.2.4.2, KIAA1630DKFZP762M115, MGC3090, probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
55526
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
dehydrogenase E1 and transketolase domain containing 1, Dehydrogenase E1 and transketolase domain-containing protein 1, DKFZp762M115, EC 1.2.4.2, KIAA1630DKFZP762M115, MGC3090, probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 55526
Common Name: DHTKD1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: dehydrogenase E1 and transketolase domain containing 1, Dehydrogenase E1 and transketolase domain-containing protein 1, DKFZp762M115, EC 1.2.4.2, KIAA1630DKFZP762M115, MGC3090, probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: −20°C, avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: DHTKD1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49941. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
55526
Common Name:
DHTKD1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
dehydrogenase E1 and transketolase domain containing 1, Dehydrogenase E1 and transketolase domain-containing protein 1, DKFZp762M115, EC 1.2.4.2, KIAA1630DKFZP762M115, MGC3090, probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
−20°C, avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
DHTKD1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49941. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml