NBP255283PE
Novus Biologicals™ Epimorphin/Syntaxin 2 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255283PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255283PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
2054
Common Name
Epimorphin/Syntaxin 2 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
EPIMepimorphin, EPM, STX2AMGC51014, STX2Bsyntaxin-2, STX2CEpimorphin, syntaxin 2
Label Type
Unlabeled
Quantity
100μL
Research Category
Neuroscience
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51323. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
STX2
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Source
E.coli
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Epimorphin/Syntaxin 2
- Source: E.coli Amino Acid Sequence: DRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNTIDKITQYVEEVKK The Epimorphin/Syntaxin 2 Recombinant Protein Antigen is derived from E
- coli
- The Epimorphin/Syntaxin 2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 2054
Common Name: Epimorphin/Syntaxin 2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: EPIMepimorphin, EPM, STX2AMGC51014, STX2Bsyntaxin-2, STX2CEpimorphin, syntaxin 2
Label Type: Unlabeled
Quantity: 100μL
Research Category: Neuroscience
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51323. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: STX2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
2054
Common Name:
Epimorphin/Syntaxin 2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
EPIMepimorphin, EPM, STX2AMGC51014, STX2Bsyntaxin-2, STX2CEpimorphin, syntaxin 2
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
Neuroscience
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51323. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
STX2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli
Gene ID (Entrez): 84085
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: F-box domain protein, F-box only protein 30, F-box only protein, helicase, 18, F-box protein 30, FBX30, FLJ41030, MGC21674
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
84085
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
F-box domain protein, F-box only protein 30, F-box only protein, helicase, 18, F-box protein 30, FBX30, FLJ41030, MGC21674
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__
Gene ID (Entrez): 3964
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Gal-8, galectin 8, galectin-8, galectin-8g, lectin, galactoside-binding, soluble, 8, PCTA1, PCTA-1Po66 carbohydrate-binding protein, Po66 carbohydrate binding protein, Po66-CBP, Prostate carcinoma tumor antigen 1
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
3964
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Gal-8, galectin 8, galectin-8, galectin-8g, lectin, galactoside-binding, soluble, 8, PCTA1, PCTA-1Po66 carbohydrate-binding protein, Po66 carbohydrate binding protein, Po66-CBP, Prostate carcinoma tumor antigen 1
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__
Gene ID (Entrez): 203522
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26B
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
203522
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26B
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__